Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Q8RA31

Protein Details
Accession A0A1Q8RA31    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
349-376GESSERQKEKDQSKKKRKGSKRGDDEFGBasic
558-596MVPFRKVGGKQRRNKGKPGRKKIGTRKVNPLKTFKARRKBasic
NLS Segment(s)
PositionSequence
356-370KEKDQSKKKRKGSKR
562-596RKVGGKQRRNKGKPGRKKIGTRKVNPLKTFKARRK
Subcellular Location(s) nucl 14.5, cyto_nucl 11, cyto 6.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR011545  DEAD/DEAH_box_helicase_dom  
IPR014001  Helicase_ATP-bd  
IPR001650  Helicase_C  
IPR027417  P-loop_NTPase  
IPR014014  RNA_helicase_DEAD_Q_motif  
Gene Ontology GO:0005524  F:ATP binding  
GO:0016787  F:hydrolase activity  
GO:0003723  F:RNA binding  
GO:0003724  F:RNA helicase activity  
Pfam View protein in Pfam  
PF00270  DEAD  
PF00271  Helicase_C  
PROSITE View protein in PROSITE  
PS51192  HELICASE_ATP_BIND_1  
PS51194  HELICASE_CTER  
PS51195  Q_MOTIF  
CDD cd17961  DEADc_DDX56  
cd18787  SF2_C_DEAD  
Amino Acid Sequences MKRKHTEESAPAVESEKRAKTEQEKPAANLSFADLGLDTRLVQAVAAESFKEPTPVQQKAIPLALDGKDVVAKAPCGSGKTAAYVLPVLSSILKRKATDSSPATTALLLVPTRELADQVLKAIEQFSAYCAKDIHAVKLVDKISDAVQRSLLSNFPDVVISTPATAWRNIESSALSLDNLTCLVLDEADLILSYGYNEDLENIARKLPKGVQLLMLSATLSTDVSVLHGIFGRKPTVLDLDDEETEADNLTQFAVSCGEDEKFLLAFIIFKLKLVKGKCLIFVNDVDRSYRLKLFLEQFQVRSCILNSELPVTSRAHVLEEFNRGVYDIIIASDEKSAIGTEEKDDNEGESSERQKEKDQSKKKRKGSKRGDDEFGVSRGIDFRNVAAVVNFDLPTSASSYTHRIGRTARAGRTGMALSFYVPSELYRKHLPTSIETAENDEKVLAKIKRQQAKQGKEVKPYVFKKEHLDAFRYRLDDALRAVTKVAVREARMRELKQELLKSEKLKRYFEENPTELQHLRHDGELRTARQQPHLRHIPEYLLPKEGKDSLTSNAIGMVPFRKVGGKQRRNKGKPGRKKIGTRKVNPLKTFKARRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.36
3 0.33
4 0.32
5 0.33
6 0.4
7 0.46
8 0.53
9 0.59
10 0.61
11 0.61
12 0.6
13 0.66
14 0.61
15 0.53
16 0.44
17 0.37
18 0.29
19 0.24
20 0.22
21 0.14
22 0.12
23 0.13
24 0.13
25 0.1
26 0.09
27 0.1
28 0.08
29 0.08
30 0.08
31 0.09
32 0.1
33 0.1
34 0.11
35 0.11
36 0.13
37 0.13
38 0.16
39 0.14
40 0.21
41 0.29
42 0.31
43 0.34
44 0.35
45 0.38
46 0.39
47 0.42
48 0.34
49 0.27
50 0.28
51 0.26
52 0.24
53 0.21
54 0.17
55 0.16
56 0.15
57 0.16
58 0.13
59 0.13
60 0.12
61 0.16
62 0.17
63 0.17
64 0.19
65 0.21
66 0.2
67 0.22
68 0.22
69 0.19
70 0.19
71 0.18
72 0.16
73 0.13
74 0.12
75 0.1
76 0.11
77 0.13
78 0.17
79 0.23
80 0.26
81 0.26
82 0.29
83 0.34
84 0.34
85 0.41
86 0.4
87 0.37
88 0.36
89 0.36
90 0.34
91 0.28
92 0.26
93 0.17
94 0.16
95 0.12
96 0.11
97 0.1
98 0.1
99 0.11
100 0.11
101 0.1
102 0.09
103 0.13
104 0.13
105 0.13
106 0.13
107 0.12
108 0.12
109 0.12
110 0.11
111 0.08
112 0.08
113 0.09
114 0.15
115 0.15
116 0.16
117 0.16
118 0.16
119 0.22
120 0.24
121 0.25
122 0.25
123 0.26
124 0.25
125 0.31
126 0.31
127 0.24
128 0.23
129 0.21
130 0.17
131 0.22
132 0.23
133 0.18
134 0.19
135 0.2
136 0.21
137 0.21
138 0.2
139 0.17
140 0.16
141 0.15
142 0.14
143 0.13
144 0.12
145 0.13
146 0.12
147 0.1
148 0.09
149 0.09
150 0.13
151 0.14
152 0.14
153 0.14
154 0.14
155 0.15
156 0.15
157 0.16
158 0.13
159 0.12
160 0.13
161 0.12
162 0.1
163 0.09
164 0.09
165 0.08
166 0.08
167 0.07
168 0.05
169 0.05
170 0.05
171 0.05
172 0.05
173 0.05
174 0.05
175 0.05
176 0.05
177 0.04
178 0.04
179 0.04
180 0.04
181 0.03
182 0.04
183 0.04
184 0.04
185 0.05
186 0.06
187 0.07
188 0.09
189 0.09
190 0.12
191 0.13
192 0.13
193 0.15
194 0.17
195 0.24
196 0.25
197 0.26
198 0.27
199 0.27
200 0.27
201 0.25
202 0.22
203 0.15
204 0.11
205 0.1
206 0.06
207 0.05
208 0.04
209 0.04
210 0.04
211 0.04
212 0.05
213 0.05
214 0.05
215 0.08
216 0.08
217 0.09
218 0.11
219 0.12
220 0.11
221 0.11
222 0.12
223 0.13
224 0.14
225 0.13
226 0.14
227 0.15
228 0.15
229 0.15
230 0.14
231 0.11
232 0.1
233 0.09
234 0.07
235 0.04
236 0.04
237 0.04
238 0.04
239 0.04
240 0.04
241 0.05
242 0.05
243 0.06
244 0.07
245 0.07
246 0.07
247 0.07
248 0.07
249 0.06
250 0.06
251 0.06
252 0.04
253 0.05
254 0.05
255 0.1
256 0.09
257 0.09
258 0.11
259 0.12
260 0.17
261 0.18
262 0.22
263 0.21
264 0.22
265 0.25
266 0.25
267 0.25
268 0.22
269 0.23
270 0.22
271 0.2
272 0.19
273 0.17
274 0.17
275 0.17
276 0.17
277 0.17
278 0.15
279 0.13
280 0.16
281 0.19
282 0.21
283 0.26
284 0.25
285 0.25
286 0.25
287 0.26
288 0.22
289 0.2
290 0.16
291 0.11
292 0.11
293 0.11
294 0.11
295 0.12
296 0.12
297 0.12
298 0.14
299 0.13
300 0.12
301 0.12
302 0.12
303 0.1
304 0.11
305 0.12
306 0.13
307 0.16
308 0.15
309 0.14
310 0.14
311 0.13
312 0.13
313 0.11
314 0.09
315 0.05
316 0.04
317 0.05
318 0.05
319 0.05
320 0.06
321 0.06
322 0.05
323 0.05
324 0.05
325 0.05
326 0.06
327 0.06
328 0.07
329 0.11
330 0.11
331 0.12
332 0.12
333 0.12
334 0.11
335 0.11
336 0.11
337 0.11
338 0.13
339 0.18
340 0.2
341 0.2
342 0.24
343 0.32
344 0.4
345 0.47
346 0.55
347 0.62
348 0.71
349 0.8
350 0.85
351 0.88
352 0.88
353 0.89
354 0.89
355 0.89
356 0.88
357 0.84
358 0.78
359 0.69
360 0.62
361 0.53
362 0.43
363 0.32
364 0.22
365 0.16
366 0.14
367 0.13
368 0.11
369 0.09
370 0.08
371 0.1
372 0.11
373 0.11
374 0.09
375 0.09
376 0.09
377 0.1
378 0.1
379 0.08
380 0.07
381 0.08
382 0.08
383 0.1
384 0.09
385 0.08
386 0.1
387 0.14
388 0.17
389 0.21
390 0.2
391 0.2
392 0.22
393 0.27
394 0.34
395 0.37
396 0.36
397 0.37
398 0.37
399 0.35
400 0.36
401 0.3
402 0.21
403 0.17
404 0.15
405 0.11
406 0.11
407 0.11
408 0.09
409 0.08
410 0.09
411 0.12
412 0.13
413 0.15
414 0.2
415 0.22
416 0.23
417 0.27
418 0.28
419 0.28
420 0.34
421 0.33
422 0.3
423 0.29
424 0.33
425 0.31
426 0.29
427 0.25
428 0.19
429 0.17
430 0.15
431 0.22
432 0.18
433 0.21
434 0.29
435 0.37
436 0.45
437 0.46
438 0.56
439 0.59
440 0.65
441 0.69
442 0.72
443 0.69
444 0.69
445 0.72
446 0.67
447 0.67
448 0.64
449 0.64
450 0.58
451 0.55
452 0.53
453 0.55
454 0.57
455 0.51
456 0.52
457 0.46
458 0.46
459 0.48
460 0.42
461 0.35
462 0.3
463 0.28
464 0.25
465 0.24
466 0.26
467 0.23
468 0.22
469 0.22
470 0.22
471 0.22
472 0.21
473 0.25
474 0.21
475 0.22
476 0.3
477 0.33
478 0.39
479 0.44
480 0.43
481 0.43
482 0.44
483 0.48
484 0.46
485 0.47
486 0.42
487 0.42
488 0.47
489 0.47
490 0.52
491 0.54
492 0.53
493 0.53
494 0.52
495 0.54
496 0.57
497 0.6
498 0.6
499 0.54
500 0.52
501 0.52
502 0.53
503 0.46
504 0.39
505 0.35
506 0.31
507 0.3
508 0.3
509 0.3
510 0.27
511 0.35
512 0.4
513 0.38
514 0.4
515 0.46
516 0.45
517 0.5
518 0.57
519 0.54
520 0.58
521 0.64
522 0.6
523 0.57
524 0.56
525 0.51
526 0.49
527 0.5
528 0.42
529 0.39
530 0.36
531 0.34
532 0.36
533 0.34
534 0.3
535 0.26
536 0.27
537 0.24
538 0.28
539 0.28
540 0.24
541 0.23
542 0.22
543 0.18
544 0.18
545 0.17
546 0.14
547 0.14
548 0.15
549 0.17
550 0.2
551 0.31
552 0.4
553 0.48
554 0.56
555 0.67
556 0.78
557 0.8
558 0.86
559 0.87
560 0.87
561 0.88
562 0.89
563 0.89
564 0.87
565 0.92
566 0.93
567 0.92
568 0.92
569 0.88
570 0.88
571 0.88
572 0.89
573 0.85
574 0.82
575 0.81
576 0.81