Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q8S449

Protein Details
Accession A0A1Q8S449   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
15-41ALKAQVENKRSRKRTKVKTSPNSKFANHydrophilic
NLS Segment(s)
PositionSequence
23-30KRSRKRTK
Subcellular Location(s) nucl 19.5, cyto_nucl 15.5, cyto 6.5
Family & Domain DBs
Amino Acid Sequences ERDVERAFSQRTIEALKAQVENKRSRKRTKVKTSPNSKFANIRAIQKAQEEAGNVETTIDESNRSESPSDEEDCIVVAVGGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.23
4 0.24
5 0.26
6 0.28
7 0.3
8 0.38
9 0.46
10 0.53
11 0.58
12 0.63
13 0.71
14 0.77
15 0.82
16 0.84
17 0.85
18 0.86
19 0.89
20 0.91
21 0.87
22 0.84
23 0.76
24 0.66
25 0.59
26 0.5
27 0.48
28 0.39
29 0.37
30 0.33
31 0.31
32 0.31
33 0.28
34 0.27
35 0.19
36 0.18
37 0.14
38 0.12
39 0.12
40 0.11
41 0.1
42 0.09
43 0.09
44 0.08
45 0.09
46 0.08
47 0.08
48 0.08
49 0.12
50 0.12
51 0.14
52 0.14
53 0.14
54 0.19
55 0.22
56 0.23
57 0.21
58 0.21
59 0.2
60 0.19
61 0.18
62 0.13