Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q8S2D6

Protein Details
Accession A0A1Q8S2D6   
Localization Confidence High
Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
142-167AYDKAVREKERKRREEEKAAEKKRHEBasic
NLS Segment(s)
PositionSequence
36-40KPKPK
147-166VREKERKRREEEKAAEKKRH
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MPSSSNKPDVTSSLSKLSLDGDKSKPSSTAASKIVKPKPKKPAVVDSWEDEDLDDDEPAEEEDKTETQDDGSKAPPPTPISPTYNTPNQSFTPYGNSTDSSSSAPGSAGSHRRPEKTDAVARRMIASALGVKVPRLTEEQRAYDKAVREKERKRREEEKAAEKKRHEDVEKAKAAIWDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.32
3 0.3
4 0.3
5 0.27
6 0.25
7 0.28
8 0.27
9 0.31
10 0.34
11 0.34
12 0.32
13 0.3
14 0.33
15 0.31
16 0.33
17 0.34
18 0.37
19 0.41
20 0.49
21 0.54
22 0.57
23 0.6
24 0.63
25 0.67
26 0.7
27 0.73
28 0.71
29 0.73
30 0.7
31 0.7
32 0.64
33 0.57
34 0.52
35 0.45
36 0.39
37 0.28
38 0.23
39 0.16
40 0.14
41 0.11
42 0.07
43 0.06
44 0.07
45 0.07
46 0.07
47 0.06
48 0.05
49 0.07
50 0.08
51 0.09
52 0.09
53 0.09
54 0.09
55 0.13
56 0.14
57 0.14
58 0.14
59 0.18
60 0.17
61 0.18
62 0.21
63 0.2
64 0.22
65 0.24
66 0.26
67 0.26
68 0.28
69 0.3
70 0.31
71 0.32
72 0.32
73 0.29
74 0.29
75 0.25
76 0.26
77 0.24
78 0.2
79 0.21
80 0.2
81 0.21
82 0.19
83 0.19
84 0.17
85 0.17
86 0.18
87 0.13
88 0.13
89 0.11
90 0.1
91 0.09
92 0.08
93 0.08
94 0.11
95 0.16
96 0.17
97 0.25
98 0.28
99 0.3
100 0.32
101 0.36
102 0.37
103 0.39
104 0.44
105 0.42
106 0.44
107 0.44
108 0.42
109 0.38
110 0.33
111 0.26
112 0.19
113 0.14
114 0.11
115 0.1
116 0.11
117 0.1
118 0.1
119 0.11
120 0.11
121 0.12
122 0.15
123 0.17
124 0.24
125 0.29
126 0.34
127 0.36
128 0.38
129 0.4
130 0.4
131 0.42
132 0.42
133 0.46
134 0.49
135 0.54
136 0.62
137 0.69
138 0.76
139 0.78
140 0.79
141 0.8
142 0.81
143 0.83
144 0.82
145 0.82
146 0.82
147 0.83
148 0.82
149 0.76
150 0.73
151 0.7
152 0.7
153 0.62
154 0.61
155 0.61
156 0.64
157 0.65
158 0.6
159 0.55