Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Q8RJF5

Protein Details
Accession A0A1Q8RJF5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
123-149ETDWQLLNKPPPKRRRRTPGLWSQTIHHydrophilic
NLS Segment(s)
PositionSequence
132-139PPPKRRRR
Subcellular Location(s) plas 20, mito 3, E.R. 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAFLSYLSGVFAFATLPMRLAWKPVALSINLVLVLLSPLVLMASYVIAWGQAIVDFIASLELACGACIGIVTGLTLSCTSTVITSVLGMRDNGLRSAPPTPMPSTPSSERPGTGKTEDSSSYETDWQLLNKPPPKRRRRTPGLWSQTIHEEDDDDSEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.09
4 0.09
5 0.13
6 0.13
7 0.16
8 0.16
9 0.16
10 0.17
11 0.19
12 0.21
13 0.18
14 0.2
15 0.17
16 0.17
17 0.14
18 0.14
19 0.1
20 0.07
21 0.07
22 0.05
23 0.05
24 0.03
25 0.03
26 0.03
27 0.03
28 0.03
29 0.03
30 0.03
31 0.03
32 0.03
33 0.03
34 0.03
35 0.03
36 0.03
37 0.03
38 0.03
39 0.03
40 0.03
41 0.03
42 0.03
43 0.03
44 0.04
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.02
57 0.02
58 0.02
59 0.02
60 0.03
61 0.03
62 0.03
63 0.03
64 0.04
65 0.04
66 0.04
67 0.04
68 0.05
69 0.05
70 0.05
71 0.05
72 0.05
73 0.06
74 0.06
75 0.06
76 0.06
77 0.08
78 0.09
79 0.09
80 0.09
81 0.08
82 0.09
83 0.11
84 0.12
85 0.12
86 0.14
87 0.16
88 0.18
89 0.21
90 0.22
91 0.26
92 0.28
93 0.3
94 0.31
95 0.3
96 0.29
97 0.28
98 0.28
99 0.27
100 0.26
101 0.24
102 0.21
103 0.24
104 0.24
105 0.24
106 0.25
107 0.22
108 0.21
109 0.21
110 0.2
111 0.18
112 0.18
113 0.16
114 0.18
115 0.23
116 0.29
117 0.34
118 0.43
119 0.51
120 0.6
121 0.7
122 0.76
123 0.81
124 0.83
125 0.86
126 0.87
127 0.88
128 0.89
129 0.87
130 0.83
131 0.74
132 0.67
133 0.64
134 0.56
135 0.47
136 0.36
137 0.28
138 0.23