Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Q8RTK4

Protein Details
Accession A0A1Q8RTK4    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
87-109REEPGSAKKDKSRKKDKKKKTSGBasic
NLS Segment(s)
PositionSequence
92-109SAKKDKSRKKDKKKKTSG
Subcellular Location(s) nucl 15.5, cyto_nucl 12, cyto 7.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR028217  Rsa3_C  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF14615  Rsa3  
Amino Acid Sequences MSAVDFSSFYLQRTTQEFAEDLDKVRAADDFKADSVPFLVHALQQGSALYSPADQARVMNSPSVPVVPAAVEGVDEDADVDMDAGNREEPGSAKKDKSRKKDKKKKTSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.21
3 0.23
4 0.22
5 0.2
6 0.23
7 0.21
8 0.19
9 0.17
10 0.17
11 0.15
12 0.15
13 0.15
14 0.13
15 0.14
16 0.14
17 0.14
18 0.14
19 0.15
20 0.15
21 0.13
22 0.12
23 0.11
24 0.09
25 0.08
26 0.08
27 0.07
28 0.08
29 0.09
30 0.08
31 0.08
32 0.08
33 0.07
34 0.07
35 0.07
36 0.05
37 0.05
38 0.05
39 0.06
40 0.06
41 0.06
42 0.06
43 0.07
44 0.09
45 0.09
46 0.1
47 0.09
48 0.09
49 0.1
50 0.1
51 0.08
52 0.06
53 0.06
54 0.05
55 0.05
56 0.05
57 0.04
58 0.04
59 0.04
60 0.05
61 0.04
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.04
68 0.03
69 0.04
70 0.05
71 0.05
72 0.06
73 0.06
74 0.06
75 0.07
76 0.08
77 0.12
78 0.17
79 0.21
80 0.26
81 0.34
82 0.44
83 0.53
84 0.62
85 0.7
86 0.76
87 0.83
88 0.89
89 0.92