Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Q8S353

Protein Details
Accession A0A1Q8S353    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
331-353ATGLLKTKKYARQPSHRGRRAGGHydrophilic
NLS Segment(s)
PositionSequence
339-352KYARQPSHRGRRAG
Subcellular Location(s) cyto 11.5, cyto_nucl 8, mito 7, extr 4, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036866  RibonucZ/Hydroxyglut_hydro  
Pfam View protein in Pfam  
PF13483  Lactamase_B_3  
Amino Acid Sequences MALTVKQLNADASFLLTFEPIVPQSIPGITPRPFRILMDPWIIGPSTIFHSILSTTTHKQCPCVCSLRHLPEPDLVIISQHNSDHCNEATLRQLPASGSRTKILAEPMAAKVIRSWKYFDNDKVHMIPRWEDPRTSGKESVIRLRVPPHVPGGEPGEVSVAFIPQRRDFKGLHAAIGITYRPPPTSPRFTHLFTPSETPLAQHGQKTVAANLTPPTPPSTPGTRPLRSVRSAPSLGPKQQLSPRDRAVSVIFSPHGIPYRSLRPYADSHLAAESALPLTALLHCFNTVSNPWWLGGNISAGMPAGQETAAALGARAWVSTHDGDKHVRGLATGLLKTKKYARQPSHRGRRAGGEKDKGTEVLVLGVGEEVAMTGDGVWNVEAGDRAPPPGKGLSRAERSLTGRARGRNLSPIDTAAKYVTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.09
4 0.09
5 0.08
6 0.11
7 0.1
8 0.12
9 0.13
10 0.13
11 0.14
12 0.15
13 0.16
14 0.16
15 0.21
16 0.22
17 0.28
18 0.31
19 0.34
20 0.34
21 0.35
22 0.39
23 0.38
24 0.4
25 0.4
26 0.37
27 0.32
28 0.32
29 0.3
30 0.23
31 0.18
32 0.15
33 0.13
34 0.15
35 0.15
36 0.13
37 0.14
38 0.15
39 0.16
40 0.19
41 0.19
42 0.23
43 0.29
44 0.36
45 0.35
46 0.4
47 0.43
48 0.44
49 0.46
50 0.48
51 0.42
52 0.44
53 0.53
54 0.55
55 0.57
56 0.55
57 0.5
58 0.46
59 0.47
60 0.4
61 0.33
62 0.25
63 0.19
64 0.17
65 0.17
66 0.15
67 0.14
68 0.14
69 0.14
70 0.16
71 0.19
72 0.18
73 0.19
74 0.18
75 0.19
76 0.24
77 0.25
78 0.24
79 0.2
80 0.21
81 0.18
82 0.24
83 0.26
84 0.23
85 0.23
86 0.23
87 0.24
88 0.23
89 0.25
90 0.21
91 0.19
92 0.17
93 0.18
94 0.18
95 0.22
96 0.21
97 0.19
98 0.19
99 0.26
100 0.29
101 0.27
102 0.29
103 0.3
104 0.36
105 0.41
106 0.45
107 0.44
108 0.42
109 0.44
110 0.45
111 0.43
112 0.39
113 0.36
114 0.31
115 0.31
116 0.36
117 0.34
118 0.3
119 0.31
120 0.37
121 0.41
122 0.44
123 0.39
124 0.35
125 0.38
126 0.41
127 0.44
128 0.4
129 0.35
130 0.32
131 0.33
132 0.37
133 0.34
134 0.33
135 0.29
136 0.26
137 0.25
138 0.25
139 0.26
140 0.21
141 0.19
142 0.17
143 0.14
144 0.12
145 0.13
146 0.1
147 0.07
148 0.07
149 0.1
150 0.13
151 0.16
152 0.2
153 0.22
154 0.25
155 0.24
156 0.28
157 0.35
158 0.33
159 0.29
160 0.26
161 0.24
162 0.21
163 0.21
164 0.16
165 0.07
166 0.09
167 0.09
168 0.09
169 0.1
170 0.14
171 0.19
172 0.28
173 0.29
174 0.32
175 0.35
176 0.36
177 0.41
178 0.4
179 0.36
180 0.29
181 0.3
182 0.26
183 0.24
184 0.22
185 0.17
186 0.15
187 0.17
188 0.17
189 0.14
190 0.14
191 0.14
192 0.16
193 0.16
194 0.15
195 0.13
196 0.11
197 0.11
198 0.11
199 0.12
200 0.1
201 0.1
202 0.13
203 0.12
204 0.13
205 0.16
206 0.2
207 0.21
208 0.29
209 0.36
210 0.33
211 0.37
212 0.4
213 0.42
214 0.39
215 0.4
216 0.35
217 0.34
218 0.33
219 0.31
220 0.33
221 0.32
222 0.33
223 0.34
224 0.3
225 0.28
226 0.32
227 0.39
228 0.35
229 0.36
230 0.37
231 0.37
232 0.36
233 0.34
234 0.31
235 0.26
236 0.22
237 0.19
238 0.15
239 0.13
240 0.14
241 0.13
242 0.15
243 0.13
244 0.14
245 0.15
246 0.23
247 0.24
248 0.25
249 0.24
250 0.25
251 0.27
252 0.31
253 0.32
254 0.25
255 0.24
256 0.23
257 0.22
258 0.18
259 0.16
260 0.11
261 0.06
262 0.06
263 0.05
264 0.04
265 0.04
266 0.06
267 0.07
268 0.07
269 0.07
270 0.08
271 0.08
272 0.08
273 0.1
274 0.11
275 0.12
276 0.13
277 0.13
278 0.13
279 0.14
280 0.14
281 0.12
282 0.12
283 0.1
284 0.09
285 0.08
286 0.08
287 0.07
288 0.07
289 0.06
290 0.05
291 0.05
292 0.04
293 0.04
294 0.04
295 0.05
296 0.05
297 0.05
298 0.05
299 0.04
300 0.06
301 0.06
302 0.06
303 0.06
304 0.06
305 0.1
306 0.12
307 0.15
308 0.16
309 0.19
310 0.21
311 0.23
312 0.24
313 0.23
314 0.21
315 0.18
316 0.17
317 0.18
318 0.2
319 0.2
320 0.23
321 0.24
322 0.25
323 0.27
324 0.33
325 0.36
326 0.42
327 0.51
328 0.56
329 0.63
330 0.74
331 0.83
332 0.87
333 0.87
334 0.81
335 0.73
336 0.73
337 0.71
338 0.7
339 0.68
340 0.65
341 0.59
342 0.59
343 0.58
344 0.48
345 0.4
346 0.32
347 0.23
348 0.16
349 0.14
350 0.11
351 0.09
352 0.09
353 0.07
354 0.06
355 0.05
356 0.03
357 0.03
358 0.03
359 0.03
360 0.03
361 0.05
362 0.05
363 0.06
364 0.06
365 0.06
366 0.06
367 0.07
368 0.07
369 0.07
370 0.11
371 0.11
372 0.14
373 0.16
374 0.17
375 0.19
376 0.26
377 0.28
378 0.3
379 0.37
380 0.43
381 0.48
382 0.51
383 0.5
384 0.5
385 0.52
386 0.55
387 0.52
388 0.51
389 0.51
390 0.53
391 0.57
392 0.56
393 0.56
394 0.55
395 0.54
396 0.5
397 0.46
398 0.44
399 0.42
400 0.37
401 0.36