Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q8RZV1

Protein Details
Accession A0A1Q8RZV1   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
15-45GCTCTTCHIAKRRSHKKSRNGCKSLRRSQAKHydrophilic
NLS Segment(s)
PositionSequence
25-33KRRSHKKSR
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, extr 2
Family & Domain DBs
Amino Acid Sequences MSEPGATSVNHGDPGCTCTTCHIAKRRSHKKSRNGCKSLRRSQAKVWAVRESAHLLCLCFTAADLRFTTRSRRIIRQRWPAAGKETGPPTERLGIGAPTFEPSPRWQYWSIVGYHKFHASQHSSRRRYVSGAFIAFTLDLDGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.19
4 0.18
5 0.18
6 0.23
7 0.27
8 0.33
9 0.38
10 0.43
11 0.5
12 0.61
13 0.69
14 0.73
15 0.8
16 0.82
17 0.84
18 0.87
19 0.91
20 0.91
21 0.87
22 0.85
23 0.85
24 0.85
25 0.84
26 0.84
27 0.79
28 0.72
29 0.7
30 0.72
31 0.68
32 0.64
33 0.57
34 0.51
35 0.45
36 0.42
37 0.38
38 0.32
39 0.25
40 0.21
41 0.19
42 0.14
43 0.14
44 0.13
45 0.11
46 0.07
47 0.07
48 0.08
49 0.08
50 0.1
51 0.1
52 0.11
53 0.13
54 0.14
55 0.2
56 0.21
57 0.28
58 0.3
59 0.39
60 0.47
61 0.54
62 0.62
63 0.68
64 0.67
65 0.66
66 0.64
67 0.57
68 0.52
69 0.45
70 0.37
71 0.31
72 0.29
73 0.25
74 0.24
75 0.24
76 0.22
77 0.22
78 0.21
79 0.18
80 0.16
81 0.15
82 0.14
83 0.13
84 0.11
85 0.1
86 0.1
87 0.1
88 0.11
89 0.12
90 0.19
91 0.2
92 0.24
93 0.23
94 0.25
95 0.3
96 0.31
97 0.31
98 0.32
99 0.34
100 0.33
101 0.34
102 0.34
103 0.3
104 0.28
105 0.33
106 0.32
107 0.37
108 0.45
109 0.53
110 0.55
111 0.59
112 0.63
113 0.57
114 0.55
115 0.5
116 0.48
117 0.44
118 0.41
119 0.37
120 0.32
121 0.31
122 0.26
123 0.23