Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0VIT0

Protein Details
Accession G0VIT0   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
228-257KTPTNIISSKKKSKTKSKHAINGKNSHYDRHydrophilic
NLS Segment(s)
PositionSequence
237-245KKKSKTKSK
Subcellular Location(s) plas 18, nucl 3, pero 3, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001142  DUP/COS  
Gene Ontology GO:0016020  C:membrane  
KEGG ncs:NCAS_0H00970  -  
Pfam View protein in Pfam  
PF00674  DUP  
Amino Acid Sequences MDARSMKMDEYCPIDNDRELAHLPCHKFPSKFRYFLSESCSSITVIIFLIIDLIFASATVIELLLTHDDSAAGGFGIGLFASSLTTVIISCIFFFQRTETITGTQAKMKFFLEIIQYKPNATSKSWDVIAAHMNTYFYREGHWANENFFYSGKECYNWFMELTTKVEYVPIEQPPRASQEDSSEPIENSKKPTPTSTTSIPIAQPIPHVADANPNANPVVINKWAQNKTPTNIISSKKKSKTKSKHAINGKNSHYDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.27
3 0.27
4 0.24
5 0.21
6 0.21
7 0.21
8 0.23
9 0.28
10 0.31
11 0.34
12 0.4
13 0.43
14 0.45
15 0.5
16 0.55
17 0.56
18 0.57
19 0.54
20 0.56
21 0.55
22 0.54
23 0.53
24 0.47
25 0.4
26 0.37
27 0.36
28 0.28
29 0.24
30 0.21
31 0.14
32 0.1
33 0.09
34 0.07
35 0.06
36 0.06
37 0.05
38 0.05
39 0.05
40 0.05
41 0.04
42 0.04
43 0.04
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.05
51 0.06
52 0.06
53 0.06
54 0.06
55 0.06
56 0.06
57 0.06
58 0.05
59 0.04
60 0.03
61 0.03
62 0.03
63 0.03
64 0.03
65 0.03
66 0.02
67 0.02
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.04
75 0.05
76 0.05
77 0.05
78 0.06
79 0.07
80 0.07
81 0.08
82 0.09
83 0.1
84 0.12
85 0.14
86 0.14
87 0.15
88 0.17
89 0.19
90 0.19
91 0.2
92 0.21
93 0.19
94 0.2
95 0.19
96 0.16
97 0.14
98 0.15
99 0.16
100 0.16
101 0.18
102 0.21
103 0.21
104 0.2
105 0.22
106 0.22
107 0.2
108 0.18
109 0.18
110 0.17
111 0.19
112 0.19
113 0.18
114 0.15
115 0.14
116 0.17
117 0.15
118 0.13
119 0.11
120 0.11
121 0.1
122 0.12
123 0.12
124 0.08
125 0.09
126 0.11
127 0.11
128 0.13
129 0.18
130 0.16
131 0.17
132 0.2
133 0.19
134 0.18
135 0.17
136 0.16
137 0.12
138 0.14
139 0.13
140 0.12
141 0.11
142 0.13
143 0.15
144 0.15
145 0.14
146 0.12
147 0.13
148 0.14
149 0.16
150 0.15
151 0.13
152 0.12
153 0.13
154 0.13
155 0.14
156 0.16
157 0.19
158 0.2
159 0.21
160 0.22
161 0.22
162 0.27
163 0.27
164 0.24
165 0.2
166 0.22
167 0.26
168 0.28
169 0.3
170 0.26
171 0.24
172 0.27
173 0.3
174 0.26
175 0.28
176 0.3
177 0.3
178 0.3
179 0.35
180 0.37
181 0.38
182 0.42
183 0.4
184 0.39
185 0.38
186 0.38
187 0.34
188 0.31
189 0.27
190 0.22
191 0.19
192 0.17
193 0.19
194 0.17
195 0.18
196 0.15
197 0.22
198 0.24
199 0.26
200 0.24
201 0.22
202 0.21
203 0.2
204 0.2
205 0.14
206 0.16
207 0.16
208 0.17
209 0.21
210 0.3
211 0.33
212 0.37
213 0.43
214 0.45
215 0.44
216 0.51
217 0.48
218 0.44
219 0.48
220 0.51
221 0.53
222 0.56
223 0.63
224 0.64
225 0.72
226 0.75
227 0.8
228 0.84
229 0.85
230 0.87
231 0.87
232 0.88
233 0.91
234 0.92
235 0.9
236 0.88
237 0.82