Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0VBJ8

Protein Details
Accession G0VBJ8    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MSSKPEYKKPQKYKPGPNDPALPPHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 10, nucl 9, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR044059  Csn1/TTC4_wheel  
IPR011990  TPR-like_helical_dom_sf  
IPR019734  TPR_repeat  
Gene Ontology GO:0051879  F:Hsp90 protein binding  
KEGG ncs:NCAS_0B02400  -  
Pfam View protein in Pfam  
PF18972  Wheel  
CDD cd21381  CTWD_TTC4  
Amino Acid Sequences MSSKPEYKKPQKYKPGPNDPALPPQLSEFKDKTPDEVLEELNRMPFFMTKLDESNGEGGDNLELEALKALAYEGEPHEVAENFKNQGNDLFTVKRFREARDIYNKGIEIKCENDKINEALFANRAACQLELKNYRSCINDCKHALTLNPKNIKCYYRMGKAFYLLNNIEEAKESVGFGQKVDKENKSLITLLEVIEKKDKEIKEKEAKVLREKQERKNFKIILDNAMGLRHITNINSSHPPDLLKDAKIRLEDPIDFESQLIYPALIMYPTTDEFDFVAEISELTTVQELLELILERPQEWFELPGHKNFTSKKLIAYMETETGGLIKAGKKMTFHDILKKDSPNIPLFDNSLKIYFVPKIESESWLAKWDKQKALENRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.94
3 0.9
4 0.85
5 0.82
6 0.75
7 0.74
8 0.67
9 0.56
10 0.46
11 0.42
12 0.43
13 0.37
14 0.41
15 0.34
16 0.34
17 0.42
18 0.42
19 0.41
20 0.39
21 0.38
22 0.35
23 0.36
24 0.34
25 0.29
26 0.3
27 0.27
28 0.26
29 0.25
30 0.2
31 0.18
32 0.17
33 0.16
34 0.17
35 0.19
36 0.18
37 0.21
38 0.22
39 0.22
40 0.22
41 0.23
42 0.2
43 0.17
44 0.15
45 0.12
46 0.11
47 0.1
48 0.08
49 0.06
50 0.06
51 0.06
52 0.06
53 0.05
54 0.05
55 0.05
56 0.05
57 0.05
58 0.05
59 0.08
60 0.09
61 0.12
62 0.12
63 0.12
64 0.14
65 0.14
66 0.16
67 0.17
68 0.19
69 0.17
70 0.2
71 0.2
72 0.19
73 0.21
74 0.22
75 0.2
76 0.21
77 0.22
78 0.23
79 0.29
80 0.29
81 0.33
82 0.32
83 0.33
84 0.4
85 0.4
86 0.47
87 0.51
88 0.54
89 0.49
90 0.51
91 0.48
92 0.43
93 0.4
94 0.33
95 0.25
96 0.25
97 0.28
98 0.28
99 0.28
100 0.25
101 0.26
102 0.26
103 0.24
104 0.22
105 0.18
106 0.16
107 0.16
108 0.15
109 0.13
110 0.13
111 0.13
112 0.11
113 0.11
114 0.11
115 0.12
116 0.18
117 0.23
118 0.26
119 0.28
120 0.29
121 0.32
122 0.32
123 0.33
124 0.34
125 0.32
126 0.36
127 0.35
128 0.36
129 0.34
130 0.32
131 0.32
132 0.34
133 0.38
134 0.38
135 0.45
136 0.42
137 0.45
138 0.47
139 0.47
140 0.4
141 0.41
142 0.38
143 0.39
144 0.41
145 0.41
146 0.39
147 0.39
148 0.39
149 0.31
150 0.31
151 0.23
152 0.2
153 0.18
154 0.17
155 0.14
156 0.13
157 0.12
158 0.08
159 0.07
160 0.07
161 0.07
162 0.1
163 0.1
164 0.09
165 0.14
166 0.16
167 0.2
168 0.24
169 0.24
170 0.23
171 0.24
172 0.25
173 0.22
174 0.2
175 0.15
176 0.13
177 0.13
178 0.11
179 0.15
180 0.14
181 0.14
182 0.17
183 0.17
184 0.17
185 0.22
186 0.22
187 0.24
188 0.28
189 0.36
190 0.41
191 0.44
192 0.5
193 0.5
194 0.52
195 0.53
196 0.57
197 0.55
198 0.56
199 0.6
200 0.63
201 0.68
202 0.72
203 0.7
204 0.71
205 0.66
206 0.57
207 0.59
208 0.51
209 0.45
210 0.39
211 0.34
212 0.25
213 0.23
214 0.21
215 0.13
216 0.11
217 0.08
218 0.08
219 0.07
220 0.1
221 0.11
222 0.15
223 0.18
224 0.19
225 0.19
226 0.19
227 0.19
228 0.18
229 0.22
230 0.21
231 0.2
232 0.22
233 0.23
234 0.25
235 0.26
236 0.25
237 0.22
238 0.23
239 0.21
240 0.21
241 0.22
242 0.2
243 0.19
244 0.18
245 0.16
246 0.13
247 0.14
248 0.1
249 0.07
250 0.06
251 0.06
252 0.06
253 0.05
254 0.05
255 0.05
256 0.07
257 0.08
258 0.1
259 0.09
260 0.1
261 0.1
262 0.11
263 0.1
264 0.08
265 0.08
266 0.06
267 0.06
268 0.06
269 0.06
270 0.05
271 0.05
272 0.06
273 0.05
274 0.05
275 0.05
276 0.05
277 0.05
278 0.06
279 0.07
280 0.07
281 0.09
282 0.1
283 0.09
284 0.1
285 0.11
286 0.11
287 0.11
288 0.13
289 0.12
290 0.22
291 0.23
292 0.28
293 0.32
294 0.32
295 0.36
296 0.37
297 0.41
298 0.41
299 0.4
300 0.38
301 0.38
302 0.39
303 0.36
304 0.37
305 0.33
306 0.27
307 0.26
308 0.23
309 0.17
310 0.16
311 0.14
312 0.11
313 0.1
314 0.1
315 0.15
316 0.18
317 0.2
318 0.21
319 0.24
320 0.31
321 0.36
322 0.37
323 0.43
324 0.44
325 0.49
326 0.54
327 0.53
328 0.51
329 0.49
330 0.52
331 0.46
332 0.44
333 0.4
334 0.36
335 0.37
336 0.35
337 0.33
338 0.28
339 0.25
340 0.23
341 0.21
342 0.22
343 0.22
344 0.21
345 0.22
346 0.21
347 0.26
348 0.27
349 0.3
350 0.3
351 0.31
352 0.31
353 0.34
354 0.35
355 0.34
356 0.41
357 0.47
358 0.5
359 0.52
360 0.6