Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0VAK6

Protein Details
Accession G0VAK6    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPKKRASNGRNKKGRGHVKPVRCVNCHydrophilic
82-111RIVRVRSRENRKIRAPPQRPRFNRENKVSPHydrophilic
NLS Segment(s)
PositionSequence
3-19KKRASNGRNKKGRGHVK
86-108VRSRENRKIRAPPQRPRFNRENK
Subcellular Location(s) nucl 14, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ncs:NCAS_0B04480  -  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MPKKRASNGRNKKGRGHVKPVRCVNCSKSIPKDKAIKRMAIRNIVEAAAVRDLSEASVYAEYALPKTYNKLHYCVSCAIHARIVRVRSRENRKIRAPPQRPRFNRENKVSPADAAKKAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.79
3 0.78
4 0.77
5 0.76
6 0.81
7 0.82
8 0.78
9 0.7
10 0.66
11 0.61
12 0.62
13 0.58
14 0.54
15 0.55
16 0.58
17 0.59
18 0.61
19 0.66
20 0.61
21 0.66
22 0.64
23 0.61
24 0.55
25 0.6
26 0.58
27 0.56
28 0.51
29 0.43
30 0.4
31 0.33
32 0.29
33 0.21
34 0.17
35 0.1
36 0.09
37 0.07
38 0.06
39 0.06
40 0.06
41 0.05
42 0.04
43 0.04
44 0.05
45 0.04
46 0.05
47 0.06
48 0.06
49 0.06
50 0.07
51 0.06
52 0.07
53 0.09
54 0.13
55 0.2
56 0.21
57 0.24
58 0.27
59 0.27
60 0.3
61 0.32
62 0.29
63 0.24
64 0.26
65 0.24
66 0.25
67 0.24
68 0.24
69 0.25
70 0.27
71 0.29
72 0.3
73 0.37
74 0.43
75 0.52
76 0.59
77 0.63
78 0.68
79 0.72
80 0.78
81 0.79
82 0.81
83 0.81
84 0.81
85 0.83
86 0.86
87 0.83
88 0.81
89 0.82
90 0.81
91 0.82
92 0.8
93 0.78
94 0.74
95 0.75
96 0.69
97 0.61
98 0.59
99 0.55