Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Q8RRM5

Protein Details
Accession A0A1Q8RRM5    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
111-134RMKSKDGRKIIARRRAKGRKKLGVBasic
NLS Segment(s)
PositionSequence
103-133KRRHGFLSRMKSKDGRKIIARRRAKGRKKLG
Subcellular Location(s) nucl 13.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MMRQSVTSLARGFLSRPNTQSARAVTQTLSQRTFSSLPSLRPSITPLTSAFSRPSTTPFTPTATDAADVVPQSAITEHPALGAMQIRCGPRNTMNRNTRLIQKRRHGFLSRMKSKDGRKIIARRRAKGRKKLGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.28
4 0.34
5 0.35
6 0.36
7 0.4
8 0.38
9 0.37
10 0.35
11 0.34
12 0.28
13 0.32
14 0.37
15 0.36
16 0.34
17 0.3
18 0.28
19 0.31
20 0.31
21 0.26
22 0.27
23 0.25
24 0.26
25 0.29
26 0.3
27 0.27
28 0.26
29 0.29
30 0.25
31 0.22
32 0.21
33 0.17
34 0.19
35 0.19
36 0.2
37 0.19
38 0.16
39 0.17
40 0.16
41 0.19
42 0.21
43 0.21
44 0.23
45 0.23
46 0.24
47 0.24
48 0.24
49 0.22
50 0.16
51 0.15
52 0.12
53 0.1
54 0.09
55 0.08
56 0.07
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.06
63 0.07
64 0.06
65 0.06
66 0.07
67 0.07
68 0.07
69 0.12
70 0.09
71 0.1
72 0.14
73 0.15
74 0.16
75 0.17
76 0.2
77 0.23
78 0.33
79 0.38
80 0.45
81 0.52
82 0.55
83 0.58
84 0.58
85 0.6
86 0.6
87 0.61
88 0.6
89 0.63
90 0.67
91 0.67
92 0.72
93 0.67
94 0.64
95 0.66
96 0.68
97 0.67
98 0.62
99 0.62
100 0.61
101 0.63
102 0.66
103 0.63
104 0.59
105 0.6
106 0.68
107 0.73
108 0.76
109 0.79
110 0.77
111 0.81
112 0.85
113 0.86
114 0.86