Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0VFS1

Protein Details
Accession G0VFS1   
Localization Confidence Low
Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MEPVRYKERRKQQMVRFFSATHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 3.5, cyto_nucl 3, cyto 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038814  AIM11  
Gene Ontology GO:0016020  C:membrane  
KEGG ncs:NCAS_0E02680  -  
Amino Acid Sequences MEPVRYKERRKQQMVRFFSATAITLLFTRLLMKRLQVPRYEPGMFQLNHKVPPRTDMKNDIMKAGILTTGMVGGLFSMGLYGYCWTKNISTIRDFRGNLNG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.81
3 0.72
4 0.62
5 0.53
6 0.44
7 0.35
8 0.25
9 0.18
10 0.12
11 0.09
12 0.09
13 0.08
14 0.07
15 0.1
16 0.1
17 0.12
18 0.12
19 0.13
20 0.21
21 0.28
22 0.31
23 0.31
24 0.34
25 0.36
26 0.41
27 0.4
28 0.32
29 0.28
30 0.31
31 0.28
32 0.26
33 0.29
34 0.26
35 0.3
36 0.32
37 0.31
38 0.25
39 0.29
40 0.32
41 0.28
42 0.3
43 0.31
44 0.33
45 0.39
46 0.39
47 0.35
48 0.3
49 0.27
50 0.24
51 0.18
52 0.13
53 0.06
54 0.05
55 0.05
56 0.04
57 0.04
58 0.04
59 0.03
60 0.03
61 0.03
62 0.02
63 0.02
64 0.02
65 0.02
66 0.03
67 0.04
68 0.05
69 0.07
70 0.07
71 0.08
72 0.1
73 0.11
74 0.18
75 0.23
76 0.27
77 0.32
78 0.37
79 0.43
80 0.49
81 0.49