Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9WQ04

Protein Details
Accession A0A1L9WQ04   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
87-106QNEGCFPCYRGRRPRRYGSGHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 9, mito 7, extr 5, E.R. 3, vacu 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences IVKPATNRGPAVPGSLAILFPLSVISVLVHIWGRFGPEPASRPTCFQFSPSLPTFIDHRFTLSAGPHCDYRIRNITKITSSTISSSQNEGCFPCYRGRRPRRYGSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.16
4 0.12
5 0.12
6 0.08
7 0.07
8 0.07
9 0.05
10 0.04
11 0.04
12 0.04
13 0.04
14 0.05
15 0.06
16 0.07
17 0.07
18 0.07
19 0.07
20 0.1
21 0.1
22 0.11
23 0.13
24 0.14
25 0.17
26 0.21
27 0.26
28 0.24
29 0.26
30 0.26
31 0.27
32 0.25
33 0.24
34 0.23
35 0.2
36 0.25
37 0.24
38 0.24
39 0.21
40 0.22
41 0.22
42 0.19
43 0.21
44 0.15
45 0.15
46 0.13
47 0.13
48 0.14
49 0.14
50 0.16
51 0.16
52 0.17
53 0.16
54 0.17
55 0.21
56 0.2
57 0.24
58 0.3
59 0.31
60 0.33
61 0.35
62 0.38
63 0.37
64 0.38
65 0.35
66 0.28
67 0.26
68 0.26
69 0.26
70 0.27
71 0.25
72 0.27
73 0.26
74 0.25
75 0.25
76 0.24
77 0.24
78 0.22
79 0.23
80 0.28
81 0.34
82 0.42
83 0.51
84 0.61
85 0.68
86 0.75