Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0V861

Protein Details
Accession G0V861    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MPPKEAKRRTQRRKKDPNAPKRGLSBasic
NLS Segment(s)
PositionSequence
4-22KEAKRRTQRRKKDPNAPKR
Subcellular Location(s) nucl 14.5, mito 10, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
KEGG ncs:NCAS_0A11010  -  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPPKEAKRRTQRRKKDPNAPKRGLSAYMFFANENRDIVKAENPNITFGQVGKVLGEKWKALTAEEKEPYEAKAKADKKRYESEKELYMATQVHADDEEEEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.94
3 0.94
4 0.93
5 0.93
6 0.87
7 0.78
8 0.72
9 0.64
10 0.57
11 0.48
12 0.39
13 0.32
14 0.29
15 0.27
16 0.22
17 0.21
18 0.19
19 0.17
20 0.16
21 0.13
22 0.11
23 0.12
24 0.13
25 0.17
26 0.17
27 0.19
28 0.22
29 0.22
30 0.24
31 0.23
32 0.22
33 0.17
34 0.14
35 0.14
36 0.1
37 0.09
38 0.07
39 0.07
40 0.07
41 0.1
42 0.11
43 0.09
44 0.09
45 0.12
46 0.12
47 0.12
48 0.18
49 0.19
50 0.25
51 0.27
52 0.27
53 0.26
54 0.26
55 0.27
56 0.26
57 0.23
58 0.19
59 0.26
60 0.33
61 0.39
62 0.48
63 0.53
64 0.54
65 0.63
66 0.67
67 0.66
68 0.65
69 0.62
70 0.58
71 0.53
72 0.48
73 0.39
74 0.34
75 0.27
76 0.21
77 0.19
78 0.14
79 0.13
80 0.13
81 0.14