Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9X4I9

Protein Details
Accession A0A1L9X4I9    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
154-181TIEINTQLPKKEKKKKEKEAEPQETQPQHydrophilic
NLS Segment(s)
PositionSequence
163-171KKEKKKKEK
Subcellular Location(s) mito 10.5, mito_nucl 10.166, cyto_mito 9.333, nucl 8.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR003732  Daa-tRNA_deacyls_DTD  
IPR023509  DTD-like_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0051499  F:D-aminoacyl-tRNA deacylase activity  
GO:0000049  F:tRNA binding  
Pfam View protein in Pfam  
PF02580  Tyr_Deacylase  
Amino Acid Sequences MKAVLQRVKSASVTVDGQLVSSIGQGLLVLAGVGKEDTEKDADTMVGRILKAKLWSDENEKQWKKNVQDIDGEVLCVSQFTLYGELKKGSKPDFHAAADVETARKLYDYFYQKLSNSYKPERVKNGIFQAMMEVELKNDGPVGVDYRSEDAVVTIEINTQLPKKEKKKKEKEAEPQETQPQTFEFKIPAELLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.16
4 0.16
5 0.14
6 0.13
7 0.09
8 0.08
9 0.07
10 0.05
11 0.05
12 0.05
13 0.04
14 0.04
15 0.04
16 0.03
17 0.03
18 0.03
19 0.03
20 0.03
21 0.03
22 0.04
23 0.05
24 0.07
25 0.09
26 0.09
27 0.09
28 0.1
29 0.11
30 0.11
31 0.11
32 0.11
33 0.11
34 0.11
35 0.13
36 0.13
37 0.15
38 0.17
39 0.18
40 0.19
41 0.21
42 0.24
43 0.3
44 0.35
45 0.4
46 0.48
47 0.48
48 0.47
49 0.5
50 0.54
51 0.48
52 0.49
53 0.46
54 0.38
55 0.4
56 0.39
57 0.37
58 0.3
59 0.27
60 0.2
61 0.16
62 0.13
63 0.09
64 0.08
65 0.03
66 0.03
67 0.04
68 0.07
69 0.08
70 0.09
71 0.1
72 0.12
73 0.13
74 0.14
75 0.16
76 0.15
77 0.18
78 0.21
79 0.24
80 0.26
81 0.25
82 0.25
83 0.23
84 0.21
85 0.18
86 0.14
87 0.1
88 0.07
89 0.07
90 0.05
91 0.05
92 0.05
93 0.06
94 0.13
95 0.18
96 0.19
97 0.22
98 0.25
99 0.25
100 0.31
101 0.34
102 0.32
103 0.33
104 0.36
105 0.41
106 0.44
107 0.49
108 0.49
109 0.5
110 0.47
111 0.47
112 0.48
113 0.43
114 0.38
115 0.32
116 0.28
117 0.23
118 0.21
119 0.16
120 0.1
121 0.07
122 0.08
123 0.08
124 0.07
125 0.06
126 0.05
127 0.06
128 0.07
129 0.09
130 0.09
131 0.09
132 0.1
133 0.12
134 0.13
135 0.12
136 0.11
137 0.09
138 0.09
139 0.08
140 0.08
141 0.06
142 0.07
143 0.08
144 0.08
145 0.1
146 0.11
147 0.15
148 0.21
149 0.31
150 0.41
151 0.51
152 0.61
153 0.71
154 0.8
155 0.87
156 0.92
157 0.93
158 0.93
159 0.94
160 0.93
161 0.87
162 0.82
163 0.79
164 0.72
165 0.61
166 0.52
167 0.43
168 0.38
169 0.34
170 0.3
171 0.24
172 0.21
173 0.24