Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0V969

Protein Details
Accession G0V969    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-32ASSLPHPKIVKKHSKKFKRHHSDRYHRVSENBasic
NLS Segment(s)
PositionSequence
9-25KIVKKHSKKFKRHHSDR
Subcellular Location(s) mito 13.5, mito_nucl 12.5, nucl 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ncs:NCAS_0A14610  -  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MASSLPHPKIVKKHSKKFKRHHSDRYHRVSENWRKQKGIDSVVRRRFRGNISEPTIGYGSNKKTKFLTPSGHKTFLVANVKDLETLIMHTKSYAAEIAHNVSAKNRVGILGRAKALGIKVTNPKGRLALEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.85
3 0.9
4 0.91
5 0.92
6 0.92
7 0.92
8 0.92
9 0.92
10 0.93
11 0.92
12 0.91
13 0.86
14 0.76
15 0.71
16 0.71
17 0.7
18 0.7
19 0.7
20 0.64
21 0.58
22 0.58
23 0.61
24 0.57
25 0.53
26 0.5
27 0.49
28 0.56
29 0.64
30 0.67
31 0.6
32 0.55
33 0.51
34 0.47
35 0.46
36 0.42
37 0.41
38 0.42
39 0.43
40 0.41
41 0.39
42 0.36
43 0.28
44 0.23
45 0.19
46 0.18
47 0.23
48 0.24
49 0.23
50 0.25
51 0.27
52 0.31
53 0.31
54 0.34
55 0.34
56 0.43
57 0.47
58 0.48
59 0.45
60 0.41
61 0.37
62 0.36
63 0.36
64 0.27
65 0.24
66 0.23
67 0.23
68 0.22
69 0.21
70 0.15
71 0.08
72 0.09
73 0.11
74 0.1
75 0.1
76 0.1
77 0.11
78 0.1
79 0.11
80 0.11
81 0.08
82 0.09
83 0.11
84 0.14
85 0.15
86 0.16
87 0.15
88 0.15
89 0.19
90 0.18
91 0.18
92 0.15
93 0.15
94 0.16
95 0.21
96 0.26
97 0.26
98 0.26
99 0.25
100 0.25
101 0.25
102 0.24
103 0.24
104 0.19
105 0.2
106 0.28
107 0.36
108 0.42
109 0.41
110 0.43
111 0.42