Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9X3D7

Protein Details
Accession A0A1L9X3D7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
185-204IYAKRERERAKGKQGGKKNLBasic
NLS Segment(s)
PositionSequence
188-203KRERERAKGKQGGKKN
Subcellular Location(s) plas 21, mito 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR024960  PEMT/MFAP  
IPR007318  Phopholipid_MeTrfase  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0031966  C:mitochondrial membrane  
GO:0080101  F:phosphatidyl-N-dimethylethanolamine N-methyltransferase activity  
GO:0000773  F:phosphatidyl-N-methylethanolamine N-methyltransferase activity  
GO:0032259  P:methylation  
GO:0006656  P:phosphatidylcholine biosynthetic process  
Pfam View protein in Pfam  
PF04191  PEMT  
PROSITE View protein in PROSITE  
PS51599  SAM_PEMT_PEM2  
Amino Acid Sequences MASLSNFVDLSQPSLQWAALSIAFNPIFWNIVARAEYRNHFLTRIFGGNPYYGCYFLAVTIFGIGILRDHVYQTALADQPYYAPVHQPVLGGLLFSIGSVLVLSSMWALGVTGTYLGDYFGILMDAPVTGFPFNVTGSPMYWGSTLNFLGVALYRGKVAGLFLTAEVFILYWFALQWEDPFTAEIYAKRERERAKGKQGGKKNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.14
4 0.15
5 0.12
6 0.13
7 0.13
8 0.12
9 0.17
10 0.17
11 0.17
12 0.17
13 0.15
14 0.14
15 0.13
16 0.15
17 0.1
18 0.13
19 0.14
20 0.15
21 0.18
22 0.21
23 0.23
24 0.25
25 0.28
26 0.26
27 0.26
28 0.25
29 0.25
30 0.24
31 0.25
32 0.21
33 0.19
34 0.2
35 0.21
36 0.2
37 0.2
38 0.18
39 0.15
40 0.15
41 0.13
42 0.12
43 0.1
44 0.1
45 0.08
46 0.07
47 0.06
48 0.06
49 0.05
50 0.05
51 0.04
52 0.04
53 0.05
54 0.05
55 0.05
56 0.06
57 0.06
58 0.07
59 0.07
60 0.07
61 0.1
62 0.1
63 0.09
64 0.09
65 0.09
66 0.09
67 0.1
68 0.1
69 0.07
70 0.07
71 0.08
72 0.1
73 0.11
74 0.1
75 0.09
76 0.1
77 0.1
78 0.08
79 0.07
80 0.06
81 0.05
82 0.05
83 0.05
84 0.02
85 0.03
86 0.02
87 0.02
88 0.02
89 0.02
90 0.02
91 0.02
92 0.02
93 0.02
94 0.02
95 0.02
96 0.02
97 0.02
98 0.02
99 0.02
100 0.02
101 0.03
102 0.03
103 0.03
104 0.03
105 0.03
106 0.03
107 0.03
108 0.03
109 0.03
110 0.03
111 0.03
112 0.03
113 0.03
114 0.03
115 0.04
116 0.04
117 0.04
118 0.04
119 0.05
120 0.05
121 0.06
122 0.07
123 0.07
124 0.08
125 0.1
126 0.1
127 0.1
128 0.1
129 0.1
130 0.1
131 0.12
132 0.12
133 0.1
134 0.09
135 0.08
136 0.08
137 0.08
138 0.09
139 0.07
140 0.07
141 0.07
142 0.07
143 0.07
144 0.07
145 0.07
146 0.06
147 0.06
148 0.06
149 0.06
150 0.07
151 0.07
152 0.07
153 0.06
154 0.06
155 0.05
156 0.05
157 0.04
158 0.04
159 0.04
160 0.04
161 0.05
162 0.06
163 0.07
164 0.1
165 0.1
166 0.11
167 0.12
168 0.12
169 0.13
170 0.15
171 0.16
172 0.18
173 0.25
174 0.28
175 0.3
176 0.37
177 0.4
178 0.48
179 0.56
180 0.6
181 0.64
182 0.7
183 0.75
184 0.77