Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0VEL3

Protein Details
Accession G0VEL3    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
63-84NSGEKRARKVAKKRLGSFKRAKBasic
NLS Segment(s)
PositionSequence
65-86GEKRARKVAKKRLGSFKRAKAK
Subcellular Location(s) mito 18, cyto 6, nucl 3, cyto_pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ncs:NCAS_0D04230  -  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
PROSITE View protein in PROSITE  
PS01190  RIBOSOMAL_L36E  
Amino Acid Sequences MAVKSGIAVGLNKGKKVTSMTPAPKISYKKGVSSNRTKFVRSLVKEIAGLAPYERRLIDLVRNSGEKRARKVAKKRLGSFKRAKAKVEEMNNVIAASRRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.28
4 0.28
5 0.27
6 0.34
7 0.39
8 0.46
9 0.47
10 0.48
11 0.48
12 0.48
13 0.46
14 0.46
15 0.42
16 0.4
17 0.48
18 0.53
19 0.55
20 0.61
21 0.63
22 0.63
23 0.63
24 0.58
25 0.5
26 0.49
27 0.5
28 0.42
29 0.41
30 0.34
31 0.33
32 0.32
33 0.32
34 0.25
35 0.17
36 0.14
37 0.09
38 0.08
39 0.08
40 0.09
41 0.08
42 0.08
43 0.08
44 0.09
45 0.14
46 0.17
47 0.19
48 0.21
49 0.23
50 0.23
51 0.28
52 0.34
53 0.32
54 0.33
55 0.4
56 0.46
57 0.54
58 0.63
59 0.68
60 0.71
61 0.77
62 0.8
63 0.81
64 0.8
65 0.8
66 0.8
67 0.79
68 0.79
69 0.74
70 0.69
71 0.64
72 0.66
73 0.64
74 0.62
75 0.59
76 0.5
77 0.5
78 0.47
79 0.4
80 0.33