Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9WXB4

Protein Details
Accession A0A1L9WXB4    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
334-354DTINRLLRKQAPKRRGRIPAAHydrophilic
NLS Segment(s)
PositionSequence
312-330RRAEMARRRKNLSEKRNEE
337-350NRLLRKQAPKRRGR
Subcellular Location(s) nucl 13.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029523  INO80B/Ies2  
IPR006880  INO80B_C  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF04795  PAPA-1  
Amino Acid Sequences MSLRRSLRSHGGRNDQSSMIDINDSSRSTRSTRAAAAAATTTTAATAASSTPAVTAVCVPSDVSGKSSKRSIHLTVKMPSNKLREVTGGSSRGAPATRRSVNVFTENPIITGPRTSRPRKKLVEVDTSDEDDLEDQEEDEVDDEDAPGEDEDDEDEEEDEEDEEEDEDLDAEGDLDMDDAPPQPPVPKRHAKAAAAAAAAAPSAKAVKSVEEKEMELDDDDDDDDEELSEPDTDAEGEPDDQDESMLVTGNGGEELDEEDEEDEDLDSDGTPTADLTRMTKRQRGNLGNDFLQLPMEPQVKKHLTAEERAMRRAEMARRRKNLSEKRNEEEKMDTINRLLRKQAPKRRGRIPAAEAAENATADQEIQEAYQKPDPTMVRWVSGRAGSRVGVPEEWVGTPAAQVFGAGPGKIVQEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.6
3 0.52
4 0.45
5 0.37
6 0.28
7 0.22
8 0.17
9 0.16
10 0.18
11 0.18
12 0.18
13 0.18
14 0.21
15 0.23
16 0.29
17 0.31
18 0.32
19 0.34
20 0.36
21 0.36
22 0.33
23 0.31
24 0.26
25 0.21
26 0.17
27 0.14
28 0.1
29 0.09
30 0.08
31 0.06
32 0.05
33 0.06
34 0.06
35 0.07
36 0.07
37 0.07
38 0.08
39 0.09
40 0.08
41 0.08
42 0.1
43 0.1
44 0.1
45 0.1
46 0.1
47 0.11
48 0.14
49 0.13
50 0.14
51 0.2
52 0.22
53 0.25
54 0.3
55 0.31
56 0.33
57 0.38
58 0.43
59 0.45
60 0.51
61 0.54
62 0.54
63 0.61
64 0.61
65 0.59
66 0.59
67 0.54
68 0.5
69 0.46
70 0.42
71 0.35
72 0.34
73 0.35
74 0.34
75 0.31
76 0.28
77 0.28
78 0.26
79 0.26
80 0.23
81 0.21
82 0.2
83 0.26
84 0.28
85 0.29
86 0.33
87 0.35
88 0.37
89 0.41
90 0.37
91 0.31
92 0.33
93 0.31
94 0.27
95 0.24
96 0.21
97 0.16
98 0.18
99 0.18
100 0.21
101 0.29
102 0.38
103 0.47
104 0.54
105 0.63
106 0.65
107 0.7
108 0.71
109 0.7
110 0.71
111 0.64
112 0.62
113 0.55
114 0.52
115 0.43
116 0.34
117 0.27
118 0.17
119 0.15
120 0.1
121 0.08
122 0.06
123 0.06
124 0.06
125 0.06
126 0.06
127 0.06
128 0.05
129 0.05
130 0.05
131 0.05
132 0.05
133 0.06
134 0.05
135 0.05
136 0.04
137 0.04
138 0.05
139 0.06
140 0.06
141 0.05
142 0.06
143 0.06
144 0.06
145 0.06
146 0.06
147 0.05
148 0.05
149 0.05
150 0.05
151 0.05
152 0.05
153 0.05
154 0.05
155 0.04
156 0.04
157 0.04
158 0.03
159 0.03
160 0.03
161 0.03
162 0.03
163 0.03
164 0.03
165 0.04
166 0.04
167 0.05
168 0.05
169 0.05
170 0.09
171 0.14
172 0.19
173 0.26
174 0.34
175 0.36
176 0.44
177 0.49
178 0.46
179 0.45
180 0.44
181 0.39
182 0.3
183 0.28
184 0.2
185 0.14
186 0.13
187 0.08
188 0.05
189 0.03
190 0.03
191 0.03
192 0.04
193 0.05
194 0.07
195 0.12
196 0.14
197 0.17
198 0.17
199 0.17
200 0.17
201 0.18
202 0.15
203 0.11
204 0.1
205 0.07
206 0.06
207 0.06
208 0.05
209 0.05
210 0.05
211 0.04
212 0.04
213 0.04
214 0.04
215 0.05
216 0.05
217 0.04
218 0.04
219 0.05
220 0.05
221 0.05
222 0.05
223 0.05
224 0.06
225 0.06
226 0.06
227 0.06
228 0.05
229 0.05
230 0.05
231 0.04
232 0.04
233 0.05
234 0.04
235 0.04
236 0.04
237 0.04
238 0.04
239 0.03
240 0.03
241 0.03
242 0.04
243 0.05
244 0.05
245 0.05
246 0.05
247 0.05
248 0.06
249 0.05
250 0.04
251 0.04
252 0.05
253 0.05
254 0.04
255 0.05
256 0.05
257 0.05
258 0.05
259 0.04
260 0.05
261 0.06
262 0.07
263 0.1
264 0.17
265 0.24
266 0.28
267 0.34
268 0.37
269 0.42
270 0.51
271 0.55
272 0.56
273 0.57
274 0.57
275 0.52
276 0.5
277 0.43
278 0.34
279 0.28
280 0.2
281 0.13
282 0.14
283 0.17
284 0.16
285 0.16
286 0.26
287 0.27
288 0.29
289 0.3
290 0.32
291 0.31
292 0.34
293 0.42
294 0.41
295 0.42
296 0.43
297 0.41
298 0.33
299 0.34
300 0.36
301 0.37
302 0.39
303 0.47
304 0.54
305 0.59
306 0.64
307 0.68
308 0.73
309 0.75
310 0.76
311 0.76
312 0.73
313 0.75
314 0.78
315 0.72
316 0.64
317 0.58
318 0.49
319 0.46
320 0.41
321 0.35
322 0.29
323 0.33
324 0.35
325 0.32
326 0.35
327 0.35
328 0.44
329 0.53
330 0.61
331 0.66
332 0.72
333 0.77
334 0.82
335 0.83
336 0.8
337 0.78
338 0.73
339 0.72
340 0.66
341 0.6
342 0.51
343 0.44
344 0.37
345 0.28
346 0.23
347 0.14
348 0.1
349 0.09
350 0.08
351 0.06
352 0.05
353 0.06
354 0.12
355 0.14
356 0.18
357 0.24
358 0.25
359 0.25
360 0.31
361 0.32
362 0.3
363 0.37
364 0.35
365 0.34
366 0.34
367 0.36
368 0.32
369 0.35
370 0.36
371 0.29
372 0.3
373 0.26
374 0.29
375 0.3
376 0.3
377 0.25
378 0.23
379 0.23
380 0.23
381 0.22
382 0.2
383 0.16
384 0.13
385 0.14
386 0.13
387 0.12
388 0.09
389 0.09
390 0.09
391 0.14
392 0.16
393 0.14
394 0.14
395 0.15