Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9WIU5

Protein Details
Accession A0A1L9WIU5    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
59-85IGGMPTRKRGRARRPPQPYRHRQTTPAHydrophilic
NLS Segment(s)
PositionSequence
65-75RKRGRARRPPQ
Subcellular Location(s) mito 11, cyto_nucl 6.5, nucl 6, cyto 5, extr 2, cysk 2
Family & Domain DBs
Amino Acid Sequences MAGLHGLSMLVPVSGERLHWGSTNGVHFGGSVQYQSLNIFLATTHQLIPSGVLRVMAHIGGMPTRKRGRARRPPQPYRHRQTTPAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.07
3 0.09
4 0.11
5 0.12
6 0.13
7 0.14
8 0.14
9 0.17
10 0.19
11 0.17
12 0.16
13 0.14
14 0.13
15 0.12
16 0.12
17 0.09
18 0.07
19 0.06
20 0.06
21 0.07
22 0.07
23 0.07
24 0.06
25 0.05
26 0.05
27 0.05
28 0.06
29 0.07
30 0.08
31 0.08
32 0.08
33 0.08
34 0.08
35 0.09
36 0.08
37 0.08
38 0.08
39 0.08
40 0.08
41 0.08
42 0.09
43 0.08
44 0.07
45 0.06
46 0.06
47 0.07
48 0.11
49 0.11
50 0.18
51 0.22
52 0.28
53 0.37
54 0.46
55 0.56
56 0.63
57 0.73
58 0.76
59 0.84
60 0.88
61 0.91
62 0.92
63 0.92
64 0.9
65 0.9
66 0.84