Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9X8Y6

Protein Details
Accession A0A1L9X8Y6   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
60-83RVRAHPPPPASKRTRRGCCRAPRRBasic
NLS Segment(s)
PositionSequence
60-75RVRAHPPPPASKRTRR
Subcellular Location(s) nucl 11, cyto 8, cysk 4, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR027443  IPNS-like_sf  
Amino Acid Sequences MSIPTVDIAPWLNPHASETARQHVVDAMHDAGTTYGFFTLPRRREDEGLDRQLRGSPVPRVRAHPPPPASKRTRRGCCRAPRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.16
4 0.2
5 0.23
6 0.27
7 0.28
8 0.28
9 0.27
10 0.26
11 0.26
12 0.21
13 0.19
14 0.14
15 0.12
16 0.12
17 0.11
18 0.08
19 0.08
20 0.07
21 0.05
22 0.04
23 0.04
24 0.05
25 0.09
26 0.17
27 0.2
28 0.22
29 0.26
30 0.27
31 0.29
32 0.33
33 0.37
34 0.38
35 0.43
36 0.42
37 0.38
38 0.37
39 0.38
40 0.34
41 0.27
42 0.23
43 0.23
44 0.27
45 0.34
46 0.35
47 0.38
48 0.43
49 0.51
50 0.53
51 0.54
52 0.54
53 0.58
54 0.62
55 0.66
56 0.69
57 0.69
58 0.74
59 0.75
60 0.81
61 0.8
62 0.83
63 0.84