Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9X453

Protein Details
Accession A0A1L9X453   
Localization Confidence Low
Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MPTPKPTTKTTKAPNPKTQAQTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001497  MethylDNA_cys_MeTrfase_AS  
IPR014048  MethylDNA_cys_MeTrfase_DNA-bd  
IPR036217  MethylDNA_cys_MeTrfase_DNAb  
IPR036388  WH-like_DNA-bd_sf  
Gene Ontology GO:0003908  F:methylated-DNA-[protein]-cysteine S-methyltransferase activity  
GO:0006281  P:DNA repair  
GO:0032259  P:methylation  
Pfam View protein in Pfam  
PF01035  DNA_binding_1  
PROSITE View protein in PROSITE  
PS00374  MGMT  
CDD cd06445  ATase  
Amino Acid Sequences MPTPKPTTKTTKAPNPKTQAQTPSLAPTTTTTTTTSNPTRNKTLHRIRTHPTLPPHRRNIYMTLLTVPAGRWTTYAALARHLGTSPRAVGAAMRLNPFAPEVPCHRVLGGGGRLLVGYSGGPGAGAGRARDGVGMKRRLLEEEGVVFDGEGRAGGVCYVDFGEGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.81
3 0.83
4 0.79
5 0.77
6 0.73
7 0.65
8 0.59
9 0.51
10 0.5
11 0.43
12 0.36
13 0.3
14 0.25
15 0.27
16 0.25
17 0.25
18 0.2
19 0.21
20 0.23
21 0.28
22 0.32
23 0.34
24 0.38
25 0.41
26 0.45
27 0.47
28 0.52
29 0.55
30 0.61
31 0.63
32 0.64
33 0.64
34 0.63
35 0.68
36 0.64
37 0.6
38 0.58
39 0.59
40 0.62
41 0.65
42 0.68
43 0.62
44 0.63
45 0.59
46 0.55
47 0.5
48 0.42
49 0.34
50 0.28
51 0.25
52 0.22
53 0.19
54 0.15
55 0.11
56 0.1
57 0.09
58 0.08
59 0.09
60 0.1
61 0.12
62 0.16
63 0.13
64 0.14
65 0.15
66 0.15
67 0.15
68 0.14
69 0.12
70 0.09
71 0.1
72 0.08
73 0.08
74 0.07
75 0.07
76 0.07
77 0.08
78 0.11
79 0.12
80 0.13
81 0.13
82 0.13
83 0.13
84 0.14
85 0.13
86 0.1
87 0.1
88 0.14
89 0.18
90 0.2
91 0.2
92 0.19
93 0.18
94 0.17
95 0.2
96 0.18
97 0.14
98 0.12
99 0.12
100 0.12
101 0.12
102 0.11
103 0.06
104 0.04
105 0.04
106 0.04
107 0.03
108 0.03
109 0.03
110 0.04
111 0.05
112 0.07
113 0.06
114 0.08
115 0.08
116 0.09
117 0.1
118 0.12
119 0.17
120 0.25
121 0.29
122 0.29
123 0.32
124 0.33
125 0.34
126 0.35
127 0.3
128 0.24
129 0.22
130 0.23
131 0.21
132 0.2
133 0.17
134 0.14
135 0.13
136 0.1
137 0.07
138 0.05
139 0.05
140 0.05
141 0.05
142 0.06
143 0.05
144 0.06
145 0.07