Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9WHP2

Protein Details
Accession A0A1L9WHP2    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
11-38PCLETGQRQRARNRKRLRALARGSREKGHydrophilic
NLS Segment(s)
PositionSequence
19-66QRARNRKRLRALARGSREKGSWKKNVKVNARVKAKVKAKVKAKVNAKV
Subcellular Location(s) nucl 15.5, mito_nucl 12.166, cyto_nucl 10.833, mito 7.5
Family & Domain DBs
Amino Acid Sequences MTLDSRSTSIPCLETGQRQRARNRKRLRALARGSREKGSWKKNVKVNARVKAKVKAKVKAKVNAKVNAKVNAKVNTMVNARVNARVNAKSKREEERGGERGEREGAREEMREEMSTKTVNVEEDESQHRWADSQESVVHDDTVCGYSKNPADPNRYDPGNWNGLFEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.38
3 0.46
4 0.5
5 0.55
6 0.64
7 0.7
8 0.76
9 0.77
10 0.8
11 0.8
12 0.83
13 0.87
14 0.85
15 0.85
16 0.84
17 0.83
18 0.82
19 0.8
20 0.74
21 0.66
22 0.6
23 0.58
24 0.58
25 0.56
26 0.56
27 0.56
28 0.6
29 0.62
30 0.7
31 0.69
32 0.71
33 0.72
34 0.71
35 0.7
36 0.68
37 0.66
38 0.66
39 0.64
40 0.62
41 0.59
42 0.58
43 0.59
44 0.61
45 0.65
46 0.64
47 0.64
48 0.64
49 0.64
50 0.64
51 0.6
52 0.58
53 0.55
54 0.55
55 0.5
56 0.45
57 0.43
58 0.39
59 0.36
60 0.32
61 0.29
62 0.25
63 0.24
64 0.23
65 0.19
66 0.17
67 0.17
68 0.19
69 0.19
70 0.17
71 0.19
72 0.22
73 0.25
74 0.29
75 0.32
76 0.33
77 0.35
78 0.4
79 0.41
80 0.39
81 0.4
82 0.42
83 0.43
84 0.4
85 0.38
86 0.32
87 0.29
88 0.3
89 0.25
90 0.19
91 0.18
92 0.17
93 0.17
94 0.17
95 0.17
96 0.16
97 0.17
98 0.16
99 0.15
100 0.14
101 0.15
102 0.15
103 0.14
104 0.13
105 0.13
106 0.13
107 0.13
108 0.14
109 0.13
110 0.16
111 0.21
112 0.21
113 0.21
114 0.21
115 0.19
116 0.17
117 0.18
118 0.18
119 0.14
120 0.16
121 0.17
122 0.19
123 0.22
124 0.22
125 0.21
126 0.17
127 0.17
128 0.15
129 0.15
130 0.13
131 0.11
132 0.1
133 0.16
134 0.19
135 0.24
136 0.29
137 0.34
138 0.4
139 0.44
140 0.49
141 0.5
142 0.49
143 0.45
144 0.44
145 0.44
146 0.46
147 0.42