Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0V8H9

Protein Details
Accession G0V8H9   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MSEPPRKKARLSKRTNKRKEKVEEPIDPKBasic
NLS Segment(s)
PositionSequence
5-21PRKKARLSKRTNKRKEK
Subcellular Location(s) nucl 16, cyto_nucl 9.5, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0003723  F:RNA binding  
KEGG ncs:NCAS_0A12190  -  
Pfam View protein in Pfam  
PF13893  RRM_5  
PROSITE View protein in PROSITE  
PS50102  RRM  
CDD cd12246  RRM1_U1A_like  
Amino Acid Sequences MSEPPRKKARLSKRTNKRKEKVEEPIDPKNTLYVNNLDEKINTKRLRTNLFLLFSIYGEVLKVAISAKKQRGQAFITMRTVDEANLALISLNNEPFFDKPLHIQFSKTNSYII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.93
3 0.94
4 0.91
5 0.9
6 0.87
7 0.86
8 0.85
9 0.82
10 0.8
11 0.76
12 0.77
13 0.7
14 0.62
15 0.53
16 0.45
17 0.38
18 0.3
19 0.26
20 0.21
21 0.19
22 0.23
23 0.24
24 0.21
25 0.2
26 0.23
27 0.24
28 0.3
29 0.29
30 0.27
31 0.31
32 0.35
33 0.4
34 0.39
35 0.4
36 0.35
37 0.35
38 0.33
39 0.29
40 0.25
41 0.2
42 0.17
43 0.12
44 0.07
45 0.05
46 0.05
47 0.04
48 0.03
49 0.04
50 0.04
51 0.06
52 0.08
53 0.14
54 0.19
55 0.24
56 0.29
57 0.31
58 0.35
59 0.35
60 0.41
61 0.4
62 0.39
63 0.37
64 0.33
65 0.3
66 0.28
67 0.26
68 0.18
69 0.14
70 0.11
71 0.08
72 0.07
73 0.07
74 0.06
75 0.06
76 0.08
77 0.08
78 0.1
79 0.09
80 0.1
81 0.12
82 0.12
83 0.15
84 0.15
85 0.15
86 0.19
87 0.26
88 0.32
89 0.31
90 0.33
91 0.36
92 0.41
93 0.46