Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0VJL9

Protein Details
Accession G0VJL9    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
342-367GETVRNVKGKSKKRVNPNYNDRNDVNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 14, cyto 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR016587  Rad17  
IPR003021  Rad1_Rec1_Rad17  
Gene Ontology GO:0030896  C:checkpoint clamp complex  
GO:0003684  F:damaged DNA binding  
GO:0003690  F:double-stranded DNA binding  
GO:0004518  F:nuclease activity  
GO:0000077  P:DNA damage checkpoint signaling  
GO:0006302  P:double-strand break repair  
GO:0007131  P:reciprocal meiotic recombination  
KEGG ncs:NCAS_0I00310  -  
Pfam View protein in Pfam  
PF02144  Rad1  
Amino Acid Sequences MRLNDDDQVTKFSASTVHLEHITTALNCLTPFGTKDDVLIFIDADGLSFVRENNHVIRIQLLLSRELFMSYLYRSEVIEDEEGANHMKLCVKINHILDSVNVTNRNLDDVVECTISYDGHGSPFVFIFEDSMILERVEYSTYVIKDMDNTGLTLDKDHVIFECIMKGDVLYKALKELKEIDCKECYVYVKTSSDGDEDVFAFISKSELGFSKIRLPSNKSIIEKLQVYENDSTTICHDVPAIGFFDFASFDKIRMSTKIASKVLFRMDVHGLLSVNILSQTDDIVITDKTVATKSFDTTNKRLQLPKDYPGIVIEVCMIEKEALDDYSQREIELLMQTNELGETVRNVKGKSKKRVNPNYNDRNDVNNNLLQMENHKKIRIPESNNIQEEKDDQDNHEEEDQSNNSTYPYGTNDLPLFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.22
3 0.2
4 0.22
5 0.22
6 0.23
7 0.22
8 0.21
9 0.21
10 0.17
11 0.16
12 0.14
13 0.14
14 0.13
15 0.14
16 0.14
17 0.13
18 0.14
19 0.17
20 0.19
21 0.18
22 0.2
23 0.2
24 0.21
25 0.2
26 0.19
27 0.15
28 0.11
29 0.13
30 0.11
31 0.09
32 0.08
33 0.07
34 0.07
35 0.07
36 0.07
37 0.09
38 0.11
39 0.14
40 0.17
41 0.21
42 0.21
43 0.21
44 0.22
45 0.2
46 0.2
47 0.2
48 0.19
49 0.17
50 0.17
51 0.18
52 0.17
53 0.16
54 0.15
55 0.13
56 0.13
57 0.11
58 0.12
59 0.12
60 0.12
61 0.12
62 0.13
63 0.14
64 0.15
65 0.14
66 0.14
67 0.14
68 0.13
69 0.14
70 0.14
71 0.13
72 0.1
73 0.1
74 0.12
75 0.13
76 0.17
77 0.2
78 0.23
79 0.29
80 0.31
81 0.34
82 0.31
83 0.3
84 0.26
85 0.28
86 0.26
87 0.23
88 0.23
89 0.19
90 0.2
91 0.2
92 0.22
93 0.17
94 0.15
95 0.12
96 0.12
97 0.14
98 0.13
99 0.12
100 0.11
101 0.11
102 0.1
103 0.1
104 0.1
105 0.08
106 0.09
107 0.1
108 0.09
109 0.09
110 0.1
111 0.1
112 0.08
113 0.08
114 0.08
115 0.07
116 0.07
117 0.07
118 0.07
119 0.08
120 0.07
121 0.07
122 0.06
123 0.07
124 0.07
125 0.07
126 0.07
127 0.1
128 0.11
129 0.12
130 0.12
131 0.12
132 0.12
133 0.14
134 0.14
135 0.11
136 0.1
137 0.1
138 0.11
139 0.11
140 0.11
141 0.1
142 0.1
143 0.09
144 0.1
145 0.09
146 0.09
147 0.1
148 0.09
149 0.1
150 0.09
151 0.09
152 0.08
153 0.08
154 0.08
155 0.08
156 0.1
157 0.09
158 0.09
159 0.12
160 0.16
161 0.16
162 0.15
163 0.2
164 0.22
165 0.31
166 0.32
167 0.32
168 0.3
169 0.3
170 0.3
171 0.27
172 0.24
173 0.18
174 0.18
175 0.18
176 0.18
177 0.18
178 0.18
179 0.17
180 0.16
181 0.13
182 0.12
183 0.09
184 0.09
185 0.08
186 0.07
187 0.06
188 0.05
189 0.05
190 0.05
191 0.04
192 0.04
193 0.05
194 0.05
195 0.09
196 0.1
197 0.11
198 0.18
199 0.21
200 0.24
201 0.26
202 0.31
203 0.32
204 0.38
205 0.41
206 0.35
207 0.34
208 0.33
209 0.33
210 0.29
211 0.25
212 0.23
213 0.19
214 0.2
215 0.2
216 0.19
217 0.17
218 0.16
219 0.16
220 0.13
221 0.14
222 0.11
223 0.1
224 0.1
225 0.08
226 0.08
227 0.09
228 0.09
229 0.06
230 0.07
231 0.06
232 0.06
233 0.07
234 0.07
235 0.11
236 0.1
237 0.1
238 0.12
239 0.13
240 0.14
241 0.14
242 0.18
243 0.18
244 0.22
245 0.3
246 0.3
247 0.3
248 0.31
249 0.32
250 0.31
251 0.29
252 0.24
253 0.21
254 0.2
255 0.2
256 0.19
257 0.17
258 0.15
259 0.12
260 0.12
261 0.08
262 0.07
263 0.06
264 0.06
265 0.05
266 0.05
267 0.05
268 0.05
269 0.05
270 0.05
271 0.07
272 0.06
273 0.06
274 0.07
275 0.07
276 0.08
277 0.09
278 0.09
279 0.11
280 0.12
281 0.14
282 0.2
283 0.25
284 0.32
285 0.36
286 0.44
287 0.46
288 0.49
289 0.52
290 0.49
291 0.53
292 0.51
293 0.51
294 0.48
295 0.43
296 0.4
297 0.36
298 0.34
299 0.23
300 0.19
301 0.14
302 0.09
303 0.08
304 0.08
305 0.08
306 0.06
307 0.06
308 0.07
309 0.07
310 0.08
311 0.08
312 0.1
313 0.12
314 0.17
315 0.17
316 0.16
317 0.15
318 0.15
319 0.17
320 0.2
321 0.2
322 0.15
323 0.16
324 0.16
325 0.16
326 0.15
327 0.12
328 0.08
329 0.06
330 0.08
331 0.12
332 0.16
333 0.19
334 0.2
335 0.28
336 0.37
337 0.47
338 0.55
339 0.62
340 0.65
341 0.74
342 0.84
343 0.86
344 0.88
345 0.89
346 0.89
347 0.83
348 0.82
349 0.73
350 0.69
351 0.64
352 0.56
353 0.5
354 0.41
355 0.36
356 0.31
357 0.3
358 0.22
359 0.26
360 0.31
361 0.34
362 0.35
363 0.36
364 0.38
365 0.44
366 0.53
367 0.55
368 0.54
369 0.56
370 0.63
371 0.7
372 0.71
373 0.67
374 0.58
375 0.5
376 0.45
377 0.4
378 0.37
379 0.3
380 0.28
381 0.33
382 0.34
383 0.36
384 0.37
385 0.33
386 0.27
387 0.32
388 0.32
389 0.27
390 0.27
391 0.24
392 0.21
393 0.2
394 0.2
395 0.16
396 0.19
397 0.2
398 0.2
399 0.24