Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9X474

Protein Details
Accession A0A1L9X474    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
185-208TLKRTPPLEAPPKGKRRRTSDSEEHydrophilic
NLS Segment(s)
PositionSequence
196-201PKGKRR
Subcellular Location(s) nucl 19, cyto_nucl 12.5, cyto 4, mito 3
Family & Domain DBs
Amino Acid Sequences MAPRPALYPLKTPKGVSFPSELQDDQPYGSDTSQQDADNGPSVLPPRAYTEFLRALSPVYAGPEGLNASYTRWVLSKTLPSPVSLPSTASTSSFPGNIETKTSPTSIPPSPVASSRPVRSSSTLRRLRPLSSYPYSPITAESPQSPFTVRTPYSPADRRTMSIDTTNAGGGKTVTIQHIVTRTVTLKRTPPLEAPPKGKRRRTSDSEEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.5
3 0.44
4 0.42
5 0.36
6 0.36
7 0.38
8 0.34
9 0.29
10 0.3
11 0.27
12 0.22
13 0.2
14 0.19
15 0.18
16 0.17
17 0.21
18 0.18
19 0.2
20 0.22
21 0.21
22 0.2
23 0.2
24 0.21
25 0.18
26 0.18
27 0.15
28 0.13
29 0.15
30 0.16
31 0.15
32 0.14
33 0.17
34 0.2
35 0.23
36 0.23
37 0.27
38 0.29
39 0.3
40 0.29
41 0.24
42 0.22
43 0.19
44 0.18
45 0.13
46 0.11
47 0.1
48 0.09
49 0.09
50 0.09
51 0.09
52 0.08
53 0.09
54 0.07
55 0.08
56 0.1
57 0.1
58 0.1
59 0.1
60 0.11
61 0.11
62 0.14
63 0.19
64 0.18
65 0.24
66 0.24
67 0.24
68 0.25
69 0.25
70 0.26
71 0.19
72 0.19
73 0.14
74 0.15
75 0.15
76 0.15
77 0.13
78 0.11
79 0.12
80 0.11
81 0.1
82 0.11
83 0.12
84 0.11
85 0.13
86 0.13
87 0.14
88 0.15
89 0.15
90 0.13
91 0.13
92 0.17
93 0.15
94 0.17
95 0.16
96 0.17
97 0.17
98 0.18
99 0.19
100 0.2
101 0.22
102 0.22
103 0.23
104 0.24
105 0.25
106 0.27
107 0.32
108 0.35
109 0.42
110 0.48
111 0.46
112 0.5
113 0.5
114 0.48
115 0.46
116 0.41
117 0.38
118 0.34
119 0.35
120 0.32
121 0.33
122 0.32
123 0.27
124 0.25
125 0.2
126 0.19
127 0.18
128 0.18
129 0.17
130 0.17
131 0.18
132 0.18
133 0.17
134 0.17
135 0.23
136 0.21
137 0.22
138 0.25
139 0.27
140 0.34
141 0.39
142 0.4
143 0.39
144 0.39
145 0.38
146 0.38
147 0.38
148 0.32
149 0.29
150 0.27
151 0.22
152 0.21
153 0.2
154 0.16
155 0.14
156 0.12
157 0.09
158 0.08
159 0.09
160 0.1
161 0.1
162 0.12
163 0.12
164 0.15
165 0.17
166 0.18
167 0.17
168 0.19
169 0.21
170 0.24
171 0.27
172 0.28
173 0.32
174 0.35
175 0.37
176 0.38
177 0.4
178 0.45
179 0.51
180 0.54
181 0.57
182 0.62
183 0.7
184 0.76
185 0.8
186 0.79
187 0.79
188 0.81
189 0.81