Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0VI59

Protein Details
Accession G0VI59    Localization Confidence Low Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MVNVPKTRKTYCKGRNCRKHTQHKVTQYKAGKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, cyto_nucl 9.5, mito 9, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ncs:NCAS_0D00500  -  
ncs:NCAS_0G02060  -  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNVPKTRKTYCKGRNCRKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGFGGQTKPVFHKKAKTTKKVVLRLECVACKTKAQLVLKRCKHFELGGEKKQKGAALQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.86
3 0.86
4 0.9
5 0.9
6 0.91
7 0.91
8 0.9
9 0.88
10 0.88
11 0.9
12 0.83
13 0.81
14 0.75
15 0.69
16 0.62
17 0.56
18 0.45
19 0.37
20 0.35
21 0.34
22 0.33
23 0.29
24 0.34
25 0.38
26 0.42
27 0.47
28 0.52
29 0.49
30 0.55
31 0.63
32 0.6
33 0.61
34 0.59
35 0.58
36 0.56
37 0.55
38 0.48
39 0.41
40 0.37
41 0.3
42 0.31
43 0.31
44 0.3
45 0.28
46 0.33
47 0.38
48 0.47
49 0.55
50 0.6
51 0.61
52 0.64
53 0.71
54 0.72
55 0.7
56 0.66
57 0.6
58 0.57
59 0.54
60 0.48
61 0.42
62 0.38
63 0.31
64 0.27
65 0.25
66 0.24
67 0.28
68 0.33
69 0.37
70 0.42
71 0.52
72 0.6
73 0.64
74 0.63
75 0.58
76 0.55
77 0.5
78 0.49
79 0.49
80 0.5
81 0.53
82 0.59
83 0.56
84 0.55
85 0.55
86 0.49