Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9WJH8

Protein Details
Accession A0A1L9WJH8    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
73-103AKALRQVMRKFKRRKQLRRDRILKRYLRRFDBasic
NLS Segment(s)
PositionSequence
80-97MRKFKRRKQLRRDRILKR
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, mito 3
Family & Domain DBs
Amino Acid Sequences MLLQQPLTSIVRFWNPECLSGPYWHNLPKDQTVKTGAEWTPEEDYLRMENVAYEIDTGAISAGPLPFLCWADAKALRQVMRKFKRRKQLRRDRILKRYLRRFDLTINTECPDFWPIVWFEDHPVPVRDFRQFCETRDVKLLIADPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.3
3 0.32
4 0.34
5 0.36
6 0.33
7 0.33
8 0.35
9 0.28
10 0.3
11 0.33
12 0.32
13 0.31
14 0.33
15 0.38
16 0.41
17 0.39
18 0.39
19 0.38
20 0.38
21 0.35
22 0.37
23 0.29
24 0.27
25 0.27
26 0.26
27 0.24
28 0.23
29 0.23
30 0.16
31 0.18
32 0.15
33 0.14
34 0.12
35 0.09
36 0.08
37 0.08
38 0.08
39 0.07
40 0.06
41 0.05
42 0.05
43 0.05
44 0.05
45 0.04
46 0.04
47 0.03
48 0.04
49 0.04
50 0.04
51 0.04
52 0.04
53 0.05
54 0.06
55 0.06
56 0.06
57 0.07
58 0.1
59 0.12
60 0.12
61 0.14
62 0.16
63 0.18
64 0.23
65 0.27
66 0.34
67 0.42
68 0.51
69 0.57
70 0.61
71 0.7
72 0.75
73 0.81
74 0.82
75 0.85
76 0.86
77 0.88
78 0.91
79 0.9
80 0.88
81 0.87
82 0.84
83 0.81
84 0.81
85 0.76
86 0.72
87 0.66
88 0.59
89 0.54
90 0.54
91 0.5
92 0.43
93 0.39
94 0.34
95 0.31
96 0.29
97 0.26
98 0.19
99 0.15
100 0.11
101 0.12
102 0.12
103 0.14
104 0.16
105 0.14
106 0.16
107 0.2
108 0.22
109 0.21
110 0.23
111 0.23
112 0.26
113 0.29
114 0.33
115 0.31
116 0.33
117 0.4
118 0.4
119 0.4
120 0.47
121 0.45
122 0.41
123 0.46
124 0.44
125 0.34
126 0.35