Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0VAX1

Protein Details
Accession G0VAX1    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
9-38QNKPLFKVNIPRRVRNRNSKQPLKPKPVTYHydrophilic
68-91IRIIYPSKQKPKPRKQVTSNPSKPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, mito_nucl 13.833, mito 10, cyto_nucl 9.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR006856  MATalpha_HMGbox  
Gene Ontology GO:0005634  C:nucleus  
GO:0008301  F:DNA binding, bending  
GO:0045895  P:positive regulation of mating-type specific transcription, DNA-templated  
KEGG ncs:NCAS_0B09150  -  
Pfam View protein in Pfam  
PF04769  MATalpha_HMGbox  
PROSITE View protein in PROSITE  
PS51325  ALPHA_BOX  
Amino Acid Sequences MSSTIYCNQNKPLFKVNIPRRVRNRNSKQPLKPKPVTYDTCFNIFLKDPKNITIPQPPNWVLQELETIRIIYPSKQKPKPRKQVTSNPSKPINGFILFRSYYSRWGYGIKQTMLSQLLAKFWKSSDTDQALWDYFALQYSTVGCEMGVWV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.6
3 0.61
4 0.64
5 0.67
6 0.71
7 0.71
8 0.77
9 0.81
10 0.82
11 0.83
12 0.84
13 0.88
14 0.88
15 0.89
16 0.89
17 0.9
18 0.89
19 0.85
20 0.79
21 0.76
22 0.74
23 0.7
24 0.64
25 0.62
26 0.54
27 0.5
28 0.46
29 0.38
30 0.32
31 0.29
32 0.28
33 0.24
34 0.27
35 0.24
36 0.25
37 0.28
38 0.27
39 0.29
40 0.34
41 0.35
42 0.33
43 0.39
44 0.38
45 0.37
46 0.36
47 0.34
48 0.24
49 0.21
50 0.22
51 0.16
52 0.16
53 0.14
54 0.13
55 0.12
56 0.13
57 0.13
58 0.11
59 0.19
60 0.25
61 0.34
62 0.4
63 0.49
64 0.59
65 0.69
66 0.78
67 0.79
68 0.81
69 0.8
70 0.84
71 0.82
72 0.83
73 0.78
74 0.72
75 0.65
76 0.56
77 0.49
78 0.41
79 0.37
80 0.28
81 0.23
82 0.18
83 0.21
84 0.2
85 0.2
86 0.22
87 0.19
88 0.23
89 0.24
90 0.24
91 0.21
92 0.23
93 0.25
94 0.27
95 0.32
96 0.28
97 0.27
98 0.27
99 0.29
100 0.27
101 0.26
102 0.21
103 0.16
104 0.19
105 0.19
106 0.19
107 0.17
108 0.16
109 0.2
110 0.21
111 0.23
112 0.28
113 0.32
114 0.33
115 0.33
116 0.36
117 0.32
118 0.29
119 0.25
120 0.17
121 0.12
122 0.12
123 0.11
124 0.09
125 0.09
126 0.1
127 0.12
128 0.11
129 0.11
130 0.09