Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0V5I2

Protein Details
Accession G0V5I2    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
127-159ATDSTIKKRKGKNKEEKQRSTQKKKNTVYRDPIHydrophilic
NLS Segment(s)
PositionSequence
133-151KKRKGKNKEEKQRSTQKKK
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR040357  Vma22/CCDC115  
Gene Ontology GO:0070072  P:vacuolar proton-transporting V-type ATPase complex assembly  
KEGG ncs:NCAS_0A01600  -  
Amino Acid Sequences MQSTRNGLITLPTEDNIRETMGEAMDTNGDAPYVRLVSLLAEYDSLLEQLQSSMSDGFHNLSRANYFNKDSLRGSYGVDYWDESYIGELTVEITGSTRPEVDIIRKKPILKTDDDGDDGSLEEKPDATDSTIKKRKGKNKEEKQRSTQKKKNTVYRDPITMFGGGLMIPSSLRQCQSNFKGCIPLFTQLINCKIRLNELLEEIKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.2
4 0.18
5 0.13
6 0.12
7 0.14
8 0.12
9 0.12
10 0.11
11 0.11
12 0.1
13 0.1
14 0.09
15 0.07
16 0.07
17 0.06
18 0.06
19 0.08
20 0.08
21 0.08
22 0.07
23 0.08
24 0.08
25 0.09
26 0.1
27 0.08
28 0.07
29 0.07
30 0.08
31 0.08
32 0.08
33 0.06
34 0.06
35 0.05
36 0.05
37 0.06
38 0.05
39 0.06
40 0.07
41 0.07
42 0.08
43 0.08
44 0.09
45 0.11
46 0.12
47 0.11
48 0.11
49 0.13
50 0.15
51 0.18
52 0.2
53 0.2
54 0.23
55 0.24
56 0.26
57 0.25
58 0.25
59 0.24
60 0.22
61 0.2
62 0.18
63 0.17
64 0.15
65 0.14
66 0.12
67 0.1
68 0.1
69 0.09
70 0.08
71 0.08
72 0.07
73 0.06
74 0.05
75 0.04
76 0.05
77 0.04
78 0.04
79 0.04
80 0.04
81 0.04
82 0.05
83 0.05
84 0.05
85 0.05
86 0.06
87 0.07
88 0.13
89 0.21
90 0.23
91 0.28
92 0.3
93 0.32
94 0.33
95 0.38
96 0.35
97 0.3
98 0.3
99 0.28
100 0.28
101 0.28
102 0.26
103 0.2
104 0.17
105 0.14
106 0.12
107 0.09
108 0.07
109 0.05
110 0.05
111 0.05
112 0.06
113 0.07
114 0.08
115 0.13
116 0.15
117 0.25
118 0.32
119 0.37
120 0.43
121 0.51
122 0.59
123 0.64
124 0.73
125 0.74
126 0.78
127 0.86
128 0.89
129 0.89
130 0.88
131 0.88
132 0.88
133 0.88
134 0.83
135 0.82
136 0.82
137 0.82
138 0.83
139 0.82
140 0.8
141 0.79
142 0.76
143 0.72
144 0.63
145 0.57
146 0.49
147 0.4
148 0.3
149 0.2
150 0.17
151 0.1
152 0.08
153 0.07
154 0.05
155 0.04
156 0.06
157 0.08
158 0.1
159 0.12
160 0.14
161 0.17
162 0.26
163 0.34
164 0.42
165 0.43
166 0.43
167 0.5
168 0.48
169 0.5
170 0.43
171 0.4
172 0.32
173 0.3
174 0.33
175 0.28
176 0.36
177 0.34
178 0.32
179 0.31
180 0.31
181 0.34
182 0.34
183 0.34
184 0.29
185 0.32