Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9WXD0

Protein Details
Accession A0A1L9WXD0    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
120-143ELTKLKEWRVLRKKMKKACVIVCEHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11.5cyto_mito 11.5, mito 10.5, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR038727  NadR/Ttd14_AAA_dom  
IPR027417  P-loop_NTPase  
Pfam View protein in Pfam  
PF13521  AAA_28  
Amino Acid Sequences MSTQNQPLNIYLVGAHFTGKTTLVEGLRTHLTDSLVAELCGENGSPAIINELVRDIMRTDGFTASDVRNPTAGLELQKSTILAQHQAEEKLKGKWYISDRSGINPIVYAEVFLGRPAAEELTKLKEWRVLRKKMKKACVIVCEAPERELAIER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.09
4 0.1
5 0.11
6 0.11
7 0.11
8 0.1
9 0.14
10 0.14
11 0.16
12 0.16
13 0.18
14 0.19
15 0.19
16 0.19
17 0.17
18 0.17
19 0.15
20 0.16
21 0.16
22 0.14
23 0.13
24 0.13
25 0.11
26 0.11
27 0.1
28 0.09
29 0.05
30 0.04
31 0.05
32 0.04
33 0.04
34 0.06
35 0.06
36 0.07
37 0.07
38 0.08
39 0.08
40 0.08
41 0.09
42 0.07
43 0.08
44 0.08
45 0.09
46 0.09
47 0.09
48 0.1
49 0.1
50 0.12
51 0.1
52 0.13
53 0.14
54 0.13
55 0.13
56 0.12
57 0.12
58 0.11
59 0.11
60 0.09
61 0.1
62 0.1
63 0.1
64 0.1
65 0.1
66 0.09
67 0.1
68 0.09
69 0.1
70 0.1
71 0.12
72 0.13
73 0.15
74 0.16
75 0.17
76 0.18
77 0.18
78 0.2
79 0.19
80 0.18
81 0.22
82 0.25
83 0.29
84 0.28
85 0.31
86 0.3
87 0.31
88 0.34
89 0.29
90 0.24
91 0.18
92 0.17
93 0.14
94 0.13
95 0.11
96 0.08
97 0.08
98 0.08
99 0.08
100 0.08
101 0.06
102 0.07
103 0.07
104 0.08
105 0.07
106 0.09
107 0.11
108 0.16
109 0.19
110 0.19
111 0.19
112 0.24
113 0.27
114 0.37
115 0.45
116 0.5
117 0.59
118 0.69
119 0.78
120 0.81
121 0.87
122 0.85
123 0.83
124 0.81
125 0.76
126 0.73
127 0.67
128 0.62
129 0.59
130 0.51
131 0.43
132 0.36
133 0.3