Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0VI58

Protein Details
Accession G0VI58   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
4-24TTNNIKKKKGANTTKKSPPLCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
KEGG ncs:NCAS_0G02050  -  
Amino Acid Sequences MTVTTNNIKKKKGANTTKKSPPLCPDCGSVLQKCLIQQNYAMVICPDEKCGYPFNQRRVQENLVYVDDSEVIPVAKQRLSDRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.73
3 0.8
4 0.84
5 0.84
6 0.77
7 0.71
8 0.69
9 0.64
10 0.6
11 0.53
12 0.47
13 0.42
14 0.45
15 0.43
16 0.35
17 0.3
18 0.26
19 0.24
20 0.23
21 0.25
22 0.2
23 0.17
24 0.17
25 0.17
26 0.17
27 0.16
28 0.15
29 0.09
30 0.09
31 0.1
32 0.1
33 0.1
34 0.09
35 0.09
36 0.11
37 0.14
38 0.16
39 0.25
40 0.32
41 0.37
42 0.44
43 0.46
44 0.49
45 0.53
46 0.54
47 0.47
48 0.43
49 0.39
50 0.33
51 0.32
52 0.27
53 0.21
54 0.18
55 0.14
56 0.11
57 0.08
58 0.07
59 0.07
60 0.09
61 0.12
62 0.12
63 0.15