Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9UGB4

Protein Details
Accession A0A1L9UGB4    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
78-113GKIVRVRSREGRRNRAPPPRIRYNKDGKKLNPPQAAHydrophilic
NLS Segment(s)
PositionSequence
82-109RVRSREGRRNRAPPPRIRYNKDGKKLNP
Subcellular Location(s) mito 12.5, mito_nucl 11, nucl 8.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MARLSGRNKNGRGHVKPVRCSNCARCTPKDKAIKRFTIRNMVESAAIRDISDASVFTDYAVPKMYLKLQYCVSCAIHGKIVRVRSREGRRNRAPPPRIRYNKDGKKLNPPQAAKAM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.67
3 0.7
4 0.73
5 0.7
6 0.64
7 0.66
8 0.65
9 0.65
10 0.66
11 0.65
12 0.62
13 0.63
14 0.67
15 0.69
16 0.71
17 0.68
18 0.69
19 0.71
20 0.73
21 0.71
22 0.71
23 0.66
24 0.67
25 0.6
26 0.52
27 0.46
28 0.37
29 0.34
30 0.27
31 0.24
32 0.15
33 0.14
34 0.12
35 0.1
36 0.1
37 0.08
38 0.08
39 0.06
40 0.05
41 0.06
42 0.06
43 0.06
44 0.08
45 0.08
46 0.08
47 0.09
48 0.09
49 0.08
50 0.1
51 0.12
52 0.15
53 0.17
54 0.19
55 0.21
56 0.22
57 0.23
58 0.25
59 0.23
60 0.19
61 0.19
62 0.18
63 0.19
64 0.19
65 0.21
66 0.22
67 0.28
68 0.31
69 0.32
70 0.35
71 0.4
72 0.49
73 0.55
74 0.62
75 0.65
76 0.69
77 0.76
78 0.8
79 0.81
80 0.8
81 0.8
82 0.79
83 0.8
84 0.81
85 0.79
86 0.79
87 0.79
88 0.81
89 0.8
90 0.81
91 0.74
92 0.76
93 0.79
94 0.81
95 0.79
96 0.72