Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9UXM5

Protein Details
Accession A0A1L9UXM5    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
37-61TGEKKAPKGCRSRRRKEPESEPERGBasic
NLS Segment(s)
PositionSequence
40-53KKAPKGCRSRRRKE
Subcellular Location(s) cyto_nucl 12.5, nucl 11, cyto 10, mito 3
Family & Domain DBs
Amino Acid Sequences MAADIVARIPGDETHVEDLPGGGQSNLERFIAYGRETGEKKAPKGCRSRRRKEPESEPERGALLQANFRPASFGPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.17
4 0.16
5 0.16
6 0.13
7 0.12
8 0.1
9 0.06
10 0.06
11 0.07
12 0.08
13 0.09
14 0.09
15 0.08
16 0.08
17 0.09
18 0.1
19 0.1
20 0.1
21 0.1
22 0.14
23 0.15
24 0.17
25 0.22
26 0.23
27 0.24
28 0.3
29 0.34
30 0.37
31 0.47
32 0.56
33 0.6
34 0.68
35 0.76
36 0.8
37 0.84
38 0.85
39 0.84
40 0.84
41 0.84
42 0.82
43 0.77
44 0.67
45 0.58
46 0.51
47 0.42
48 0.32
49 0.26
50 0.2
51 0.21
52 0.21
53 0.25
54 0.24
55 0.24
56 0.27