Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9ULV4

Protein Details
Accession A0A1L9ULV4    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
44-64EENLKREIKKLQRYRDQIKSWHydrophilic
553-572ALKNQSWRFHKQYQTWFQRHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 10.5, mito 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR038635  CCR4-NOT_su2/3/5_C_sf  
IPR012270  CCR4-NOT_su3/5  
IPR040168  Not2/3/5  
IPR007282  NOT2/3/5_C  
IPR007207  Not_N  
Gene Ontology GO:0030015  C:CCR4-NOT core complex  
GO:0005634  C:nucleus  
GO:0000932  C:P-body  
GO:0000289  P:nuclear-transcribed mRNA poly(A) tail shortening  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF04153  NOT2_3_5  
PF04065  Not3  
Amino Acid Sequences MTSRKTQQEIDKTFKKVAEGIQSFEGIYEKIRSTSNITQRDKLEENLKREIKKLQRYRDQIKSWASGNEVKDKGPLLEQRRAIETCMEQFKAVEKEMKTKAYSKEGLSAASRLDPKEKEKVETCDFLSNMVDELQQKIESFEAEEETLHMQMKKGKKDVAKTNRLSDLSRLTERHKWHVNKLELLLRSLQNGNLETAQVLDIKESIKYYVEDGHNIDYSGEDETLYDDLNLDNEAEVQFGMTGDNDRVSSQDTQSIQDEEPEIKPKVNKGESAGLRRPSAQMKSPLPVLATLHPSASTTAASGMKPAPPPTRLPGETLKYASAAAAAAASDKNGVGIAPLPPPPGASPAFPHAVPANKASATASPSVASVQPTNKPAPVLTIAAEDITGVRSKTPSVSPNVAAASTSSQTMDKVEAPAAAKEQPAPNGEATSKEEPQESEESIFHLPPGLQDLIQSFEVTRSRASASAANASPSVQRMLATSLANCPEPADAEKPRHYKPQNPYSTPLYYPQEPLTIFDDPRLYETGRIDTDTLFYLFYYRQGSYQQYLAAKALKNQSWRFHKQYQTWFQRHEEPKTITEEFEQGTYRFFDYESTWMNRRKADFKFVYKYLEDEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.53
3 0.47
4 0.45
5 0.46
6 0.41
7 0.4
8 0.37
9 0.36
10 0.34
11 0.3
12 0.26
13 0.15
14 0.15
15 0.16
16 0.15
17 0.16
18 0.18
19 0.2
20 0.26
21 0.35
22 0.43
23 0.49
24 0.53
25 0.56
26 0.58
27 0.62
28 0.57
29 0.53
30 0.54
31 0.51
32 0.52
33 0.56
34 0.6
35 0.55
36 0.55
37 0.6
38 0.59
39 0.63
40 0.67
41 0.67
42 0.71
43 0.78
44 0.84
45 0.85
46 0.8
47 0.77
48 0.73
49 0.66
50 0.59
51 0.52
52 0.48
53 0.44
54 0.42
55 0.43
56 0.39
57 0.35
58 0.35
59 0.34
60 0.3
61 0.31
62 0.35
63 0.33
64 0.39
65 0.42
66 0.42
67 0.47
68 0.46
69 0.41
70 0.37
71 0.34
72 0.33
73 0.34
74 0.33
75 0.28
76 0.27
77 0.31
78 0.3
79 0.3
80 0.3
81 0.26
82 0.33
83 0.38
84 0.42
85 0.39
86 0.42
87 0.45
88 0.46
89 0.49
90 0.42
91 0.45
92 0.41
93 0.41
94 0.36
95 0.32
96 0.25
97 0.26
98 0.27
99 0.21
100 0.26
101 0.27
102 0.3
103 0.38
104 0.39
105 0.4
106 0.43
107 0.49
108 0.48
109 0.48
110 0.46
111 0.42
112 0.4
113 0.36
114 0.31
115 0.24
116 0.2
117 0.17
118 0.16
119 0.11
120 0.13
121 0.13
122 0.13
123 0.13
124 0.13
125 0.13
126 0.11
127 0.12
128 0.11
129 0.11
130 0.11
131 0.1
132 0.11
133 0.12
134 0.12
135 0.13
136 0.12
137 0.12
138 0.18
139 0.25
140 0.3
141 0.33
142 0.38
143 0.41
144 0.49
145 0.58
146 0.62
147 0.66
148 0.63
149 0.65
150 0.65
151 0.62
152 0.55
153 0.48
154 0.44
155 0.38
156 0.39
157 0.36
158 0.34
159 0.39
160 0.41
161 0.45
162 0.48
163 0.47
164 0.51
165 0.59
166 0.58
167 0.55
168 0.55
169 0.53
170 0.44
171 0.42
172 0.37
173 0.28
174 0.27
175 0.24
176 0.22
177 0.18
178 0.18
179 0.18
180 0.14
181 0.14
182 0.11
183 0.11
184 0.1
185 0.09
186 0.08
187 0.07
188 0.07
189 0.08
190 0.09
191 0.08
192 0.09
193 0.09
194 0.09
195 0.1
196 0.16
197 0.17
198 0.18
199 0.19
200 0.21
201 0.2
202 0.19
203 0.18
204 0.11
205 0.11
206 0.1
207 0.09
208 0.06
209 0.06
210 0.07
211 0.07
212 0.07
213 0.06
214 0.05
215 0.05
216 0.06
217 0.06
218 0.05
219 0.04
220 0.05
221 0.05
222 0.05
223 0.05
224 0.04
225 0.04
226 0.04
227 0.04
228 0.04
229 0.05
230 0.05
231 0.06
232 0.06
233 0.06
234 0.07
235 0.09
236 0.11
237 0.1
238 0.15
239 0.15
240 0.17
241 0.18
242 0.2
243 0.17
244 0.17
245 0.17
246 0.14
247 0.15
248 0.17
249 0.17
250 0.16
251 0.17
252 0.19
253 0.26
254 0.26
255 0.26
256 0.25
257 0.32
258 0.34
259 0.4
260 0.42
261 0.37
262 0.36
263 0.35
264 0.34
265 0.3
266 0.29
267 0.26
268 0.27
269 0.27
270 0.28
271 0.28
272 0.26
273 0.22
274 0.21
275 0.18
276 0.14
277 0.15
278 0.14
279 0.13
280 0.12
281 0.12
282 0.12
283 0.11
284 0.09
285 0.06
286 0.08
287 0.09
288 0.09
289 0.1
290 0.1
291 0.12
292 0.13
293 0.16
294 0.16
295 0.17
296 0.19
297 0.21
298 0.26
299 0.24
300 0.27
301 0.28
302 0.28
303 0.29
304 0.28
305 0.25
306 0.19
307 0.19
308 0.15
309 0.1
310 0.07
311 0.05
312 0.04
313 0.04
314 0.04
315 0.04
316 0.04
317 0.04
318 0.04
319 0.04
320 0.04
321 0.04
322 0.03
323 0.04
324 0.06
325 0.07
326 0.08
327 0.09
328 0.09
329 0.1
330 0.1
331 0.12
332 0.12
333 0.11
334 0.12
335 0.14
336 0.16
337 0.15
338 0.16
339 0.14
340 0.16
341 0.17
342 0.16
343 0.15
344 0.14
345 0.14
346 0.14
347 0.14
348 0.13
349 0.13
350 0.12
351 0.11
352 0.11
353 0.12
354 0.12
355 0.11
356 0.11
357 0.13
358 0.16
359 0.19
360 0.2
361 0.19
362 0.19
363 0.18
364 0.18
365 0.18
366 0.15
367 0.13
368 0.12
369 0.12
370 0.11
371 0.11
372 0.08
373 0.06
374 0.06
375 0.06
376 0.05
377 0.06
378 0.06
379 0.07
380 0.1
381 0.13
382 0.16
383 0.2
384 0.23
385 0.23
386 0.25
387 0.25
388 0.23
389 0.19
390 0.17
391 0.14
392 0.11
393 0.11
394 0.09
395 0.09
396 0.09
397 0.1
398 0.11
399 0.1
400 0.11
401 0.11
402 0.12
403 0.13
404 0.14
405 0.14
406 0.14
407 0.13
408 0.15
409 0.16
410 0.17
411 0.18
412 0.19
413 0.18
414 0.19
415 0.19
416 0.19
417 0.22
418 0.24
419 0.23
420 0.22
421 0.23
422 0.21
423 0.25
424 0.25
425 0.21
426 0.19
427 0.17
428 0.19
429 0.19
430 0.18
431 0.14
432 0.12
433 0.11
434 0.09
435 0.14
436 0.12
437 0.1
438 0.11
439 0.12
440 0.14
441 0.15
442 0.15
443 0.1
444 0.13
445 0.15
446 0.15
447 0.15
448 0.13
449 0.14
450 0.15
451 0.17
452 0.17
453 0.18
454 0.23
455 0.23
456 0.23
457 0.21
458 0.21
459 0.2
460 0.18
461 0.17
462 0.11
463 0.11
464 0.11
465 0.13
466 0.16
467 0.15
468 0.15
469 0.17
470 0.19
471 0.19
472 0.18
473 0.16
474 0.13
475 0.15
476 0.17
477 0.19
478 0.22
479 0.28
480 0.36
481 0.41
482 0.44
483 0.52
484 0.53
485 0.57
486 0.62
487 0.66
488 0.68
489 0.67
490 0.69
491 0.64
492 0.64
493 0.57
494 0.54
495 0.48
496 0.4
497 0.39
498 0.36
499 0.34
500 0.3
501 0.31
502 0.28
503 0.26
504 0.24
505 0.24
506 0.25
507 0.21
508 0.24
509 0.24
510 0.2
511 0.2
512 0.23
513 0.25
514 0.24
515 0.25
516 0.23
517 0.21
518 0.21
519 0.2
520 0.18
521 0.13
522 0.12
523 0.12
524 0.12
525 0.15
526 0.17
527 0.15
528 0.17
529 0.21
530 0.25
531 0.25
532 0.27
533 0.29
534 0.27
535 0.28
536 0.28
537 0.3
538 0.27
539 0.3
540 0.36
541 0.36
542 0.43
543 0.47
544 0.54
545 0.57
546 0.65
547 0.67
548 0.67
549 0.72
550 0.72
551 0.78
552 0.79
553 0.81
554 0.79
555 0.76
556 0.72
557 0.73
558 0.72
559 0.68
560 0.66
561 0.6
562 0.57
563 0.59
564 0.56
565 0.47
566 0.42
567 0.39
568 0.31
569 0.28
570 0.27
571 0.21
572 0.22
573 0.22
574 0.21
575 0.17
576 0.16
577 0.16
578 0.16
579 0.22
580 0.26
581 0.29
582 0.35
583 0.42
584 0.46
585 0.49
586 0.52
587 0.55
588 0.54
589 0.59
590 0.6
591 0.62
592 0.66
593 0.64
594 0.64
595 0.57