Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9U5H2

Protein Details
Accession A0A1L9U5H2   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
13-42PTALWMSNKQKTRKKRKRKKLKEHLVTLDNHydrophilic
NLS Segment(s)
PositionSequence
21-34KQKTRKKRKRKKLK
Subcellular Location(s) mito 16.5, mito_nucl 13, nucl 8.5
Family & Domain DBs
Amino Acid Sequences MALKIWSAVMRGPTALWMSNKQKTRKKRKRKKLKEHLVTLDNESDPPSDEPALPADKLLHLYLSVGVRGRDIGWFHGSLPSVPDDVYRCTEHAGSCSRFGSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.18
3 0.18
4 0.23
5 0.29
6 0.36
7 0.43
8 0.5
9 0.57
10 0.65
11 0.74
12 0.77
13 0.82
14 0.86
15 0.9
16 0.93
17 0.96
18 0.97
19 0.96
20 0.97
21 0.94
22 0.91
23 0.86
24 0.78
25 0.68
26 0.59
27 0.5
28 0.38
29 0.29
30 0.22
31 0.16
32 0.13
33 0.12
34 0.11
35 0.1
36 0.09
37 0.1
38 0.11
39 0.12
40 0.1
41 0.1
42 0.09
43 0.08
44 0.1
45 0.09
46 0.07
47 0.06
48 0.07
49 0.09
50 0.09
51 0.09
52 0.09
53 0.09
54 0.09
55 0.1
56 0.1
57 0.1
58 0.1
59 0.12
60 0.14
61 0.14
62 0.15
63 0.17
64 0.17
65 0.15
66 0.16
67 0.15
68 0.13
69 0.12
70 0.14
71 0.14
72 0.17
73 0.2
74 0.2
75 0.19
76 0.21
77 0.24
78 0.22
79 0.25
80 0.29
81 0.28
82 0.29