Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9UXX3

Protein Details
Accession A0A1L9UXX3    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
40-60DLLKAFQKGQRRRRMLHRSQEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, mito 4, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016197  Chromo-like_dom_sf  
IPR000953  Chromo/chromo_shadow_dom  
PROSITE View protein in PROSITE  
PS50013  CHROMO_2  
CDD cd00024  CD_CSD  
Amino Acid Sequences MPRLARCERDAAKWYQVLIRWKNGDETWEPLGNVKEDVPDLLKAFQKGQRRRRMLHRSQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.35
3 0.37
4 0.39
5 0.37
6 0.39
7 0.36
8 0.35
9 0.37
10 0.34
11 0.33
12 0.25
13 0.26
14 0.22
15 0.21
16 0.2
17 0.19
18 0.19
19 0.16
20 0.15
21 0.11
22 0.09
23 0.08
24 0.09
25 0.09
26 0.1
27 0.1
28 0.12
29 0.15
30 0.15
31 0.19
32 0.24
33 0.32
34 0.41
35 0.5
36 0.58
37 0.63
38 0.68
39 0.75
40 0.81