FuNGI

A0A1L9UTM0

Protein Details

Accession

A0A1L9UTM0

Localization Confidence

Medium

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
15-37	HRNSPFRYRHAPKPLIRPARRGF	Basic
571-603	EESKWEEKVRREKAEKSKDKKAKTQPADELPPI	Hydrophilic

NLS Segment(s)

Position	Sequence
578-593	KVRREKAEKSKDKKAK

Subcellular Location(s)

mito 18, cyto 5, cyto_nucl 5, nucl 3

Family & Domain DBs

InterPro	View protein in InterPro IPR003593 AAA+_ATPase IPR003959 ATPase_AAA_core IPR019489 Clp_ATPase_C IPR027417 P-loop_NTPase
Gene Ontology	GO:0005524 F:ATP binding GO:0016887 F:ATP hydrolysis activity
Pfam	View protein in Pfam PF07724 AAA_2 PF10431 ClpB_D2-small

Amino Acid Sequences

MLRLPIQARGLLRAHRNSPFRYRHAPKPLIRPARRGFNSSSTTFPTWSQFDRSDFTNQPWTGSYEPDVPTAGPLASAPAFGAPRVTPRTLKQYLDQFVVGQDRAKKILSVAVFNHYQRVQELQRRDEENAELLAKRARREAIEHHPVEDEFPGQQQTVHITPEAGALPTSAQSGLEDSPALQLEKSNILLLGPSGVGKTLMAKTLARILSVPFSISDCTPFTQAGYIGEDAEVCIHRLLAAANYDVEQAERGIIVLDEVDKIAAAKVSHGKDVSGEGVQQALLKLIEGTTVQVQAKQERSAPRVGNSPNTFPSNNPLGNSPFNPNGGNLPQKGEVYNVRTDNILFIFSGAFVGLHKVIMDRISRGSIGFGQPVRGSAITNNRSRDIAPGHNEPIPILPGSEEEALYRKHLPFFTSASSPSSPDSEPTYFNALDLLNPTDLQNYGFIPELVGRVPVTAALSTLTTPLLVRILTEPRNSLLAQYTTLFSLSGIELRFTTPALHKIASNAFTMGTGARALRTELETILSDAMFETPGSSVKFVLVTESVAERNEKPIYLARGQGGRFHSMIAAEESKWEEKVRREKAEKSKDKKAKTQPADELPPISSFREYRTQTAGF

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.48
2	0.52
3	0.57
4	0.58
5	0.64
6	0.65
7	0.65
8	0.69
9	0.7
10	0.71
11	0.76
12	0.79
13	0.76
14	0.79
15	0.82
16	0.82
17	0.81
18	0.8
19	0.76
20	0.78
21	0.74
22	0.68
23	0.63
24	0.6
25	0.61
26	0.54
27	0.51
28	0.46
29	0.45
30	0.42
31	0.38
32	0.34
33	0.33
34	0.34
35	0.35
36	0.33
37	0.34
38	0.35
39	0.36
40	0.39
41	0.37
42	0.38
43	0.42
44	0.39
45	0.37
46	0.36
47	0.38
48	0.31
49	0.31
50	0.3
51	0.26
52	0.27
53	0.27
54	0.26
55	0.21
56	0.21
57	0.2
58	0.16
59	0.1
60	0.09
61	0.11
62	0.1
63	0.1
64	0.09
65	0.11
66	0.12
67	0.11
68	0.14
69	0.11
70	0.18
71	0.23
72	0.26
73	0.27
74	0.31
75	0.4
76	0.43
77	0.45
78	0.44
79	0.48
80	0.48
81	0.48
82	0.44
83	0.35
84	0.32
85	0.34
86	0.28
87	0.23
88	0.24
89	0.24
90	0.25
91	0.25
92	0.23
93	0.2
94	0.25
95	0.22
96	0.22
97	0.22
98	0.24
99	0.28
100	0.28
101	0.32
102	0.27
103	0.26
104	0.23
105	0.27
106	0.3
107	0.33
108	0.39
109	0.39
110	0.45
111	0.48
112	0.48
113	0.45
114	0.39
115	0.34
116	0.3
117	0.27
118	0.2
119	0.18
120	0.21
121	0.2
122	0.2
123	0.22
124	0.22
125	0.22
126	0.26
127	0.32
128	0.38
129	0.46
130	0.45
131	0.42
132	0.41
133	0.4
134	0.37
135	0.3
136	0.21
137	0.12
138	0.13
139	0.13
140	0.11
141	0.11
142	0.11
143	0.14
144	0.15
145	0.15
146	0.14
147	0.13
148	0.13
149	0.15
150	0.14
151	0.1
152	0.09
153	0.08
154	0.08
155	0.08
156	0.09
157	0.06
158	0.06
159	0.06
160	0.08
161	0.08
162	0.08
163	0.08
164	0.08
165	0.09
166	0.1
167	0.1
168	0.08
169	0.08
170	0.1
171	0.12
172	0.12
173	0.11
174	0.1
175	0.09
176	0.09
177	0.08
178	0.07
179	0.05
180	0.05
181	0.05
182	0.05
183	0.05
184	0.05
185	0.08
186	0.08
187	0.09
188	0.11
189	0.11
190	0.12
191	0.18
192	0.18
193	0.16
194	0.15
195	0.15
196	0.16
197	0.16
198	0.15
199	0.09
200	0.1
201	0.11
202	0.11
203	0.12
204	0.11
205	0.12
206	0.13
207	0.12
208	0.11
209	0.11
210	0.12
211	0.1
212	0.11
213	0.1
214	0.09
215	0.09
216	0.09
217	0.08
218	0.09
219	0.08
220	0.06
221	0.06
222	0.05
223	0.05
224	0.06
225	0.06
226	0.06
227	0.07
228	0.07
229	0.07
230	0.08
231	0.08
232	0.08
233	0.07
234	0.06
235	0.05
236	0.05
237	0.05
238	0.04
239	0.04
240	0.04
241	0.04
242	0.03
243	0.04
244	0.04
245	0.04
246	0.04
247	0.03
248	0.04
249	0.04
250	0.05
251	0.05
252	0.07
253	0.13
254	0.14
255	0.16
256	0.16
257	0.15
258	0.15
259	0.16
260	0.15
261	0.1
262	0.09
263	0.07
264	0.07
265	0.07
266	0.07
267	0.06
268	0.05
269	0.05
270	0.05
271	0.04
272	0.04
273	0.05
274	0.04
275	0.05
276	0.05
277	0.08
278	0.08
279	0.1
280	0.11
281	0.14
282	0.16
283	0.16
284	0.2
285	0.21
286	0.24
287	0.28
288	0.28
289	0.26
290	0.3
291	0.3
292	0.33
293	0.31
294	0.31
295	0.28
296	0.3
297	0.29
298	0.23
299	0.26
300	0.23
301	0.22
302	0.2
303	0.2
304	0.2
305	0.21
306	0.22
307	0.21
308	0.18
309	0.18
310	0.18
311	0.17
312	0.16
313	0.17
314	0.19
315	0.16
316	0.17
317	0.17
318	0.17
319	0.17
320	0.17
321	0.17
322	0.17
323	0.21
324	0.19
325	0.18
326	0.18
327	0.18
328	0.17
329	0.14
330	0.11
331	0.07
332	0.07
333	0.06
334	0.06
335	0.06
336	0.04
337	0.04
338	0.03
339	0.05
340	0.05
341	0.05
342	0.05
343	0.05
344	0.06
345	0.08
346	0.09
347	0.09
348	0.1
349	0.11
350	0.11
351	0.11
352	0.12
353	0.11
354	0.12
355	0.14
356	0.13
357	0.13
358	0.13
359	0.14
360	0.14
361	0.12
362	0.12
363	0.12
364	0.21
365	0.25
366	0.3
367	0.31
368	0.31
369	0.31
370	0.31
371	0.31
372	0.26
373	0.26
374	0.27
375	0.28
376	0.3
377	0.31
378	0.3
379	0.27
380	0.23
381	0.19
382	0.14
383	0.1
384	0.08
385	0.07
386	0.1
387	0.1
388	0.09
389	0.09
390	0.11
391	0.12
392	0.13
393	0.16
394	0.15
395	0.18
396	0.19
397	0.2
398	0.2
399	0.22
400	0.23
401	0.22
402	0.22
403	0.22
404	0.22
405	0.22
406	0.2
407	0.2
408	0.17
409	0.17
410	0.21
411	0.19
412	0.19
413	0.21
414	0.25
415	0.21
416	0.21
417	0.21
418	0.16
419	0.15
420	0.15
421	0.15
422	0.1
423	0.11
424	0.11
425	0.1
426	0.11
427	0.11
428	0.1
429	0.08
430	0.09
431	0.09
432	0.09
433	0.08
434	0.09
435	0.09
436	0.08
437	0.09
438	0.08
439	0.08
440	0.08
441	0.08
442	0.08
443	0.07
444	0.07
445	0.06
446	0.07
447	0.07
448	0.08
449	0.07
450	0.06
451	0.06
452	0.07
453	0.07
454	0.07
455	0.07
456	0.1
457	0.16
458	0.2
459	0.21
460	0.22
461	0.22
462	0.25
463	0.24
464	0.22
465	0.2
466	0.18
467	0.18
468	0.18
469	0.17
470	0.15
471	0.15
472	0.14
473	0.09
474	0.1
475	0.09
476	0.11
477	0.1
478	0.1
479	0.11
480	0.12
481	0.12
482	0.11
483	0.14
484	0.14
485	0.18
486	0.21
487	0.21
488	0.21
489	0.24
490	0.29
491	0.28
492	0.26
493	0.21
494	0.18
495	0.17
496	0.18
497	0.14
498	0.1
499	0.09
500	0.08
501	0.08
502	0.09
503	0.1
504	0.11
505	0.13
506	0.14
507	0.13
508	0.15
509	0.15
510	0.15
511	0.15
512	0.12
513	0.11
514	0.1
515	0.1
516	0.08
517	0.07
518	0.07
519	0.07
520	0.1
521	0.11
522	0.11
523	0.11
524	0.12
525	0.13
526	0.12
527	0.14
528	0.12
529	0.11
530	0.12
531	0.14
532	0.14
533	0.15
534	0.18
535	0.16
536	0.2
537	0.21
538	0.2
539	0.21
540	0.26
541	0.31
542	0.31
543	0.34
544	0.33
545	0.37
546	0.37
547	0.41
548	0.38
549	0.35
550	0.32
551	0.29
552	0.26
553	0.21
554	0.22
555	0.21
556	0.2
557	0.16
558	0.19
559	0.22
560	0.22
561	0.23
562	0.25
563	0.26
564	0.33
565	0.44
566	0.5
567	0.57
568	0.61
569	0.7
570	0.77
571	0.83
572	0.84
573	0.82
574	0.84
575	0.83
576	0.84
577	0.85
578	0.85
579	0.84
580	0.82
581	0.84
582	0.82
583	0.81
584	0.81
585	0.73
586	0.65
587	0.55
588	0.5
589	0.43
590	0.36
591	0.31
592	0.25
593	0.28
594	0.34
595	0.36
596	0.38

A0A1L9UTM0

3D AlphaFold-predicted Structure Viewer