Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9UV20

Protein Details
Accession A0A1L9UV20   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MEKRKEENRKDWQRKKRKGREEEKEEKKKIKEBasic
NLS Segment(s)
PositionSequence
3-32KRKEENRKDWQRKKRKGREEEKEEKKKIKE
Subcellular Location(s) nucl 19, cyto_nucl 13.333, mito_nucl 10.833, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MEKRKEENRKDWQRKKRKGREEEKEEKKKIKEEERSPFEATNASGRSRTLSCPCERNAGPVGAVIMCDRYPQRSYILRRQLDEPLAQRSVIGRLVLRVADPAIFSLQEGVPRTVQTDQAEHCIRQAASTSVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.95
3 0.94
4 0.94
5 0.93
6 0.94
7 0.94
8 0.92
9 0.92
10 0.92
11 0.91
12 0.87
13 0.83
14 0.77
15 0.72
16 0.71
17 0.7
18 0.69
19 0.67
20 0.72
21 0.71
22 0.71
23 0.67
24 0.59
25 0.49
26 0.41
27 0.32
28 0.28
29 0.23
30 0.19
31 0.17
32 0.17
33 0.19
34 0.19
35 0.22
36 0.21
37 0.25
38 0.26
39 0.3
40 0.31
41 0.34
42 0.33
43 0.33
44 0.3
45 0.25
46 0.22
47 0.18
48 0.18
49 0.11
50 0.11
51 0.07
52 0.06
53 0.05
54 0.06
55 0.06
56 0.09
57 0.1
58 0.11
59 0.15
60 0.21
61 0.27
62 0.36
63 0.45
64 0.44
65 0.45
66 0.46
67 0.46
68 0.41
69 0.39
70 0.32
71 0.27
72 0.25
73 0.23
74 0.21
75 0.18
76 0.18
77 0.16
78 0.14
79 0.1
80 0.1
81 0.11
82 0.11
83 0.11
84 0.09
85 0.08
86 0.08
87 0.08
88 0.08
89 0.08
90 0.08
91 0.08
92 0.1
93 0.1
94 0.13
95 0.16
96 0.17
97 0.17
98 0.17
99 0.2
100 0.19
101 0.23
102 0.22
103 0.23
104 0.23
105 0.3
106 0.34
107 0.31
108 0.31
109 0.32
110 0.29
111 0.26
112 0.27