Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9UFM8

Protein Details
Accession A0A1L9UFM8    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
4-31RLVTGRRSKRFLPKKRLRKLLRNNIDGIHydrophilic
NLS Segment(s)
PositionSequence
9-42RRSKRFLPKKRLRKLLRNNIDGITRPSIRRLARR
Subcellular Location(s) mito 12, nucl 9.5, cyto_nucl 9, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR001951  Histone_H4  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Amino Acid Sequences MDPRLVTGRRSKRFLPKKRLRKLLRNNIDGITRPSIRRLARRGGVIRIGAGVYPEVRKTVKNRLTEIMRQIILVMESSTTPSRERKLVTTRDVVFALSRMGHTLYGFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.79
3 0.79
4 0.83
5 0.88
6 0.92
7 0.9
8 0.9
9 0.9
10 0.9
11 0.89
12 0.82
13 0.74
14 0.65
15 0.59
16 0.5
17 0.43
18 0.36
19 0.29
20 0.26
21 0.26
22 0.3
23 0.31
24 0.37
25 0.37
26 0.39
27 0.4
28 0.45
29 0.45
30 0.41
31 0.4
32 0.33
33 0.29
34 0.22
35 0.19
36 0.12
37 0.1
38 0.08
39 0.06
40 0.06
41 0.06
42 0.07
43 0.08
44 0.1
45 0.13
46 0.24
47 0.29
48 0.32
49 0.35
50 0.38
51 0.43
52 0.44
53 0.45
54 0.38
55 0.32
56 0.28
57 0.26
58 0.21
59 0.16
60 0.13
61 0.09
62 0.05
63 0.05
64 0.08
65 0.09
66 0.1
67 0.12
68 0.16
69 0.19
70 0.23
71 0.25
72 0.3
73 0.37
74 0.43
75 0.46
76 0.5
77 0.49
78 0.48
79 0.46
80 0.4
81 0.32
82 0.25
83 0.22
84 0.15
85 0.13
86 0.12
87 0.13
88 0.13