Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9UC50

Protein Details
Accession A0A1L9UC50    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
140-160HDTPSEKPERRKPWERGTDNEBasic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 13.5, cyto 8.5
Family & Domain DBs
Pfam View protein in Pfam  
PF17733  DUF5572  
Amino Acid Sequences MAELQPSEIELLERLSSYPFSTDREFAVGLSIILGHPETPASEEEINRNDDLTLQAKCFYFSRKENLTPPVDFTTYKAWLESASKSKSADVSSPGSTVNISKSQEEPTYPSSFAHIVELITTGQPIPGIQQIPDTILTGHDTPSEKPERRKPWERGTDNEVSNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.12
4 0.12
5 0.15
6 0.14
7 0.18
8 0.21
9 0.22
10 0.21
11 0.23
12 0.22
13 0.19
14 0.19
15 0.15
16 0.12
17 0.1
18 0.09
19 0.06
20 0.07
21 0.07
22 0.05
23 0.05
24 0.05
25 0.05
26 0.07
27 0.08
28 0.11
29 0.13
30 0.14
31 0.17
32 0.2
33 0.22
34 0.2
35 0.2
36 0.16
37 0.15
38 0.16
39 0.15
40 0.14
41 0.12
42 0.14
43 0.14
44 0.16
45 0.16
46 0.17
47 0.2
48 0.22
49 0.28
50 0.3
51 0.33
52 0.35
53 0.4
54 0.4
55 0.35
56 0.35
57 0.31
58 0.28
59 0.25
60 0.23
61 0.21
62 0.2
63 0.19
64 0.16
65 0.13
66 0.13
67 0.15
68 0.16
69 0.17
70 0.17
71 0.18
72 0.18
73 0.19
74 0.2
75 0.19
76 0.18
77 0.15
78 0.17
79 0.16
80 0.16
81 0.16
82 0.14
83 0.13
84 0.13
85 0.12
86 0.13
87 0.13
88 0.14
89 0.16
90 0.18
91 0.19
92 0.2
93 0.21
94 0.21
95 0.23
96 0.22
97 0.21
98 0.2
99 0.2
100 0.19
101 0.17
102 0.13
103 0.1
104 0.1
105 0.1
106 0.09
107 0.08
108 0.08
109 0.06
110 0.06
111 0.06
112 0.06
113 0.06
114 0.1
115 0.11
116 0.11
117 0.13
118 0.13
119 0.15
120 0.16
121 0.15
122 0.11
123 0.11
124 0.14
125 0.13
126 0.13
127 0.15
128 0.16
129 0.17
130 0.24
131 0.33
132 0.35
133 0.43
134 0.53
135 0.6
136 0.68
137 0.77
138 0.78
139 0.8
140 0.85
141 0.82
142 0.78
143 0.75
144 0.74