Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9UKG7

Protein Details
Accession A0A1L9UKG7   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
74-98SAPVTSTTTRRRRRRHSSPTVYYLEHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 15, mito 6, plas 3, mito_nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAPITKLLSLPLHQTNTNTFSPRDNPDCPNTISGGGIAGIVLGTIAGTLLILWLWHLCSLPGSGSTWGSDYGESAPVTSTTTRRRRRRHSSPTVYYLEKHGGGGGGSVRRPTKVYLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.32
3 0.34
4 0.36
5 0.33
6 0.28
7 0.29
8 0.32
9 0.37
10 0.38
11 0.37
12 0.38
13 0.4
14 0.43
15 0.41
16 0.37
17 0.32
18 0.26
19 0.22
20 0.18
21 0.14
22 0.1
23 0.08
24 0.06
25 0.04
26 0.03
27 0.03
28 0.02
29 0.02
30 0.02
31 0.01
32 0.02
33 0.01
34 0.02
35 0.02
36 0.02
37 0.02
38 0.02
39 0.02
40 0.02
41 0.03
42 0.03
43 0.04
44 0.04
45 0.04
46 0.05
47 0.05
48 0.06
49 0.06
50 0.07
51 0.07
52 0.08
53 0.08
54 0.08
55 0.08
56 0.08
57 0.07
58 0.07
59 0.1
60 0.09
61 0.09
62 0.09
63 0.08
64 0.1
65 0.11
66 0.15
67 0.22
68 0.32
69 0.42
70 0.52
71 0.62
72 0.7
73 0.79
74 0.86
75 0.87
76 0.89
77 0.89
78 0.87
79 0.84
80 0.79
81 0.7
82 0.6
83 0.53
84 0.45
85 0.35
86 0.28
87 0.21
88 0.17
89 0.15
90 0.15
91 0.15
92 0.15
93 0.15
94 0.2
95 0.21
96 0.22
97 0.24