Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9UMX2

Protein Details
Accession A0A1L9UMX2    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
185-210ITYKRAPQLDPPPQGKKRRNLKRRNTHydrophilic
NLS Segment(s)
PositionSequence
198-209QGKKRRNLKRRN
Subcellular Location(s) nucl 14, cyto_nucl 10.5, mito 7, cyto 5
Family & Domain DBs
Amino Acid Sequences MGPTKPTLRPLTTPKSMVFPSELRERTFTTCLDPDRPSNVAKGNSSEDNEASITPPPAYTDFVNTFSPIFASPTTSRANFYKYMVDKPRQSPTSTPSSTTSSNFPSGQPPRNNSTTAVVPHPTAHGQRMRLPPPYVCTPVSDSPRSAHPLHSPFTSSDWRGRPFESPVSEAGNSFSVRHVVTTTITYKRAPQLDPPPQGKKRRNLKRRNT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.5
3 0.46
4 0.42
5 0.37
6 0.3
7 0.29
8 0.36
9 0.37
10 0.34
11 0.36
12 0.37
13 0.37
14 0.38
15 0.34
16 0.3
17 0.33
18 0.34
19 0.36
20 0.36
21 0.33
22 0.35
23 0.37
24 0.32
25 0.31
26 0.33
27 0.31
28 0.3
29 0.3
30 0.3
31 0.31
32 0.32
33 0.31
34 0.25
35 0.23
36 0.22
37 0.19
38 0.16
39 0.14
40 0.13
41 0.11
42 0.11
43 0.11
44 0.12
45 0.14
46 0.13
47 0.17
48 0.18
49 0.21
50 0.21
51 0.2
52 0.19
53 0.17
54 0.17
55 0.12
56 0.11
57 0.08
58 0.13
59 0.13
60 0.16
61 0.19
62 0.19
63 0.21
64 0.2
65 0.24
66 0.21
67 0.21
68 0.25
69 0.24
70 0.31
71 0.35
72 0.39
73 0.4
74 0.43
75 0.49
76 0.44
77 0.44
78 0.39
79 0.36
80 0.4
81 0.36
82 0.34
83 0.29
84 0.3
85 0.3
86 0.29
87 0.27
88 0.21
89 0.22
90 0.21
91 0.19
92 0.23
93 0.26
94 0.32
95 0.33
96 0.34
97 0.36
98 0.38
99 0.38
100 0.32
101 0.3
102 0.25
103 0.23
104 0.22
105 0.18
106 0.17
107 0.16
108 0.16
109 0.16
110 0.14
111 0.17
112 0.18
113 0.19
114 0.26
115 0.32
116 0.34
117 0.36
118 0.37
119 0.34
120 0.35
121 0.38
122 0.34
123 0.28
124 0.27
125 0.28
126 0.32
127 0.36
128 0.33
129 0.3
130 0.28
131 0.31
132 0.34
133 0.29
134 0.26
135 0.28
136 0.3
137 0.31
138 0.31
139 0.29
140 0.25
141 0.29
142 0.31
143 0.26
144 0.3
145 0.33
146 0.36
147 0.36
148 0.37
149 0.36
150 0.35
151 0.39
152 0.35
153 0.32
154 0.3
155 0.32
156 0.31
157 0.27
158 0.25
159 0.21
160 0.19
161 0.17
162 0.16
163 0.14
164 0.14
165 0.14
166 0.13
167 0.12
168 0.13
169 0.16
170 0.2
171 0.22
172 0.24
173 0.25
174 0.29
175 0.34
176 0.38
177 0.36
178 0.4
179 0.46
180 0.54
181 0.62
182 0.64
183 0.68
184 0.72
185 0.8
186 0.8
187 0.79
188 0.8
189 0.83
190 0.86