Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0VI74

Protein Details
Accession G0VI74    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
83-105QFGWGNKTRKRVKKQQEMLQKAIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 13.833, mito_nucl 9.666, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR011431  Trafficking_Pga2  
Gene Ontology GO:0016020  C:membrane  
KEGG ncs:NCAS_0G02220  -  
Pfam View protein in Pfam  
PF07543  PGA2  
Amino Acid Sequences MASAMDKVGNVLLKTFEDFDIYKGIRLVIIVGGYLLVRNYVAREMAKKQLERQVRDDERMLSDNKKKNLVDDPETEKMAQSTQFGWGNKTRKRVKKQQEMLQKAIEQIKKEKKFAGEDSDEDIADLLED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.15
4 0.15
5 0.16
6 0.16
7 0.21
8 0.2
9 0.2
10 0.18
11 0.18
12 0.15
13 0.15
14 0.14
15 0.08
16 0.08
17 0.06
18 0.06
19 0.06
20 0.05
21 0.06
22 0.05
23 0.04
24 0.04
25 0.04
26 0.05
27 0.06
28 0.08
29 0.09
30 0.12
31 0.15
32 0.23
33 0.28
34 0.28
35 0.31
36 0.37
37 0.43
38 0.43
39 0.45
40 0.47
41 0.45
42 0.46
43 0.43
44 0.37
45 0.32
46 0.31
47 0.28
48 0.23
49 0.28
50 0.32
51 0.32
52 0.36
53 0.33
54 0.34
55 0.39
56 0.38
57 0.35
58 0.33
59 0.38
60 0.35
61 0.36
62 0.33
63 0.26
64 0.22
65 0.19
66 0.15
67 0.1
68 0.09
69 0.12
70 0.17
71 0.17
72 0.2
73 0.26
74 0.33
75 0.36
76 0.45
77 0.51
78 0.56
79 0.65
80 0.72
81 0.76
82 0.79
83 0.84
84 0.84
85 0.86
86 0.83
87 0.78
88 0.71
89 0.61
90 0.54
91 0.52
92 0.46
93 0.38
94 0.41
95 0.47
96 0.49
97 0.5
98 0.51
99 0.49
100 0.52
101 0.53
102 0.53
103 0.47
104 0.43
105 0.46
106 0.43
107 0.38
108 0.31
109 0.27