Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0VI56

Protein Details
Accession G0VI56   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MSSSSTKNKSTKSNNNNNNTSIHydrophilic
334-357NRLPHSNDRHHNHNHNHNHRKRNRBasic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 12.833, cyto 3, cyto_pero 2.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR026231  IBD2  
Gene Ontology GO:0000922  C:spindle pole  
GO:0007094  P:mitotic spindle assembly checkpoint signaling  
KEGG ncs:NCAS_0G02030  -  
Amino Acid Sequences MSSSSTKNKSTKSNNNNNNTSIELVSEDGPMPINIMMQEGVKALTKILSNQLQDRKVFDNPQQSMQFVIRNTGGKIIKDSSHNGTSPQKQNGKMTSDDEIVELDNQSNYHVNDKSATTLQSNVLNNDDVQNFLDEEFQDPELHLDDEEGEIIFDYETHDLMDAPDGIGERISQMIESVLPNGFPKDAHGRLHAVVNGDELNITEEGDGGDDEHNQHIRPQYAPPNGRALNQTSMRRHEYDDHADAEGAEEDIDEELFEHEGCCPHHQRHGQLSEFRNYNYHDFEYLPSQVKQPPNFSVLLEQGKPMCMFCEYYMVFGEPPRNMIKWYNRTYGYNRLPHSNDRHHNHNHNHNHRKRNR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.84
3 0.84
4 0.76
5 0.68
6 0.59
7 0.51
8 0.4
9 0.31
10 0.22
11 0.19
12 0.17
13 0.15
14 0.14
15 0.11
16 0.12
17 0.11
18 0.11
19 0.1
20 0.1
21 0.09
22 0.1
23 0.1
24 0.09
25 0.1
26 0.09
27 0.1
28 0.1
29 0.1
30 0.1
31 0.12
32 0.12
33 0.14
34 0.2
35 0.25
36 0.26
37 0.34
38 0.41
39 0.43
40 0.44
41 0.45
42 0.42
43 0.42
44 0.44
45 0.42
46 0.45
47 0.43
48 0.49
49 0.47
50 0.43
51 0.4
52 0.38
53 0.35
54 0.25
55 0.26
56 0.22
57 0.22
58 0.22
59 0.27
60 0.27
61 0.24
62 0.27
63 0.27
64 0.27
65 0.28
66 0.32
67 0.3
68 0.32
69 0.32
70 0.32
71 0.37
72 0.42
73 0.46
74 0.5
75 0.5
76 0.5
77 0.55
78 0.56
79 0.53
80 0.47
81 0.43
82 0.38
83 0.33
84 0.3
85 0.24
86 0.2
87 0.16
88 0.14
89 0.12
90 0.09
91 0.08
92 0.08
93 0.09
94 0.11
95 0.11
96 0.15
97 0.16
98 0.16
99 0.17
100 0.18
101 0.19
102 0.18
103 0.19
104 0.15
105 0.16
106 0.17
107 0.21
108 0.22
109 0.2
110 0.19
111 0.18
112 0.18
113 0.19
114 0.17
115 0.12
116 0.12
117 0.11
118 0.1
119 0.1
120 0.11
121 0.08
122 0.1
123 0.11
124 0.11
125 0.1
126 0.1
127 0.1
128 0.1
129 0.1
130 0.08
131 0.07
132 0.06
133 0.06
134 0.07
135 0.06
136 0.04
137 0.04
138 0.04
139 0.04
140 0.03
141 0.05
142 0.05
143 0.05
144 0.05
145 0.05
146 0.05
147 0.05
148 0.06
149 0.05
150 0.05
151 0.05
152 0.05
153 0.05
154 0.05
155 0.05
156 0.04
157 0.05
158 0.05
159 0.04
160 0.04
161 0.04
162 0.05
163 0.05
164 0.06
165 0.05
166 0.06
167 0.06
168 0.06
169 0.06
170 0.06
171 0.08
172 0.13
173 0.16
174 0.17
175 0.18
176 0.2
177 0.2
178 0.22
179 0.21
180 0.16
181 0.14
182 0.13
183 0.11
184 0.09
185 0.08
186 0.07
187 0.07
188 0.06
189 0.06
190 0.05
191 0.05
192 0.05
193 0.05
194 0.05
195 0.04
196 0.05
197 0.05
198 0.06
199 0.08
200 0.09
201 0.09
202 0.12
203 0.14
204 0.15
205 0.16
206 0.2
207 0.26
208 0.33
209 0.35
210 0.35
211 0.4
212 0.39
213 0.4
214 0.37
215 0.33
216 0.31
217 0.34
218 0.39
219 0.35
220 0.39
221 0.41
222 0.4
223 0.39
224 0.38
225 0.38
226 0.38
227 0.37
228 0.34
229 0.3
230 0.29
231 0.26
232 0.22
233 0.16
234 0.1
235 0.07
236 0.05
237 0.05
238 0.05
239 0.05
240 0.04
241 0.04
242 0.04
243 0.05
244 0.05
245 0.05
246 0.06
247 0.09
248 0.11
249 0.15
250 0.2
251 0.21
252 0.3
253 0.34
254 0.39
255 0.45
256 0.5
257 0.5
258 0.53
259 0.56
260 0.54
261 0.52
262 0.47
263 0.41
264 0.37
265 0.36
266 0.33
267 0.3
268 0.25
269 0.24
270 0.25
271 0.26
272 0.27
273 0.26
274 0.23
275 0.24
276 0.29
277 0.35
278 0.37
279 0.38
280 0.38
281 0.37
282 0.37
283 0.35
284 0.33
285 0.31
286 0.32
287 0.28
288 0.27
289 0.24
290 0.26
291 0.25
292 0.22
293 0.17
294 0.14
295 0.15
296 0.14
297 0.22
298 0.19
299 0.21
300 0.22
301 0.22
302 0.21
303 0.21
304 0.25
305 0.17
306 0.21
307 0.23
308 0.22
309 0.24
310 0.31
311 0.39
312 0.44
313 0.51
314 0.54
315 0.54
316 0.59
317 0.61
318 0.64
319 0.62
320 0.6
321 0.56
322 0.57
323 0.59
324 0.62
325 0.66
326 0.66
327 0.67
328 0.65
329 0.71
330 0.72
331 0.78
332 0.78
333 0.79
334 0.8
335 0.81
336 0.87
337 0.87