Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9UUC1

Protein Details
Accession A0A1L9UUC1   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
68-93AERRPRPTIRGKKKMADRKRSSRSGABasic
NLS Segment(s)
PositionSequence
69-90ERRPRPTIRGKKKMADRKRSSR
Subcellular Location(s) nucl 15, mito 8, cyto 3
Family & Domain DBs
Amino Acid Sequences MLEHLCKMKLVFFPHSCSSDSMQSADDDTTAPPRPTEFNLQVRQLKSTKTGDAESFTVGAPAPAAIAAERRPRPTIRGKKKMADRKRSSRSGASYYPSSTCVVLFWLERKACKPRLFLH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.44
3 0.41
4 0.39
5 0.37
6 0.33
7 0.32
8 0.27
9 0.23
10 0.22
11 0.21
12 0.18
13 0.15
14 0.11
15 0.1
16 0.13
17 0.15
18 0.15
19 0.14
20 0.15
21 0.18
22 0.2
23 0.27
24 0.3
25 0.34
26 0.38
27 0.44
28 0.47
29 0.45
30 0.46
31 0.39
32 0.34
33 0.31
34 0.3
35 0.26
36 0.23
37 0.24
38 0.21
39 0.22
40 0.21
41 0.17
42 0.15
43 0.12
44 0.1
45 0.08
46 0.07
47 0.05
48 0.04
49 0.03
50 0.03
51 0.03
52 0.03
53 0.04
54 0.07
55 0.15
56 0.17
57 0.19
58 0.22
59 0.23
60 0.28
61 0.38
62 0.47
63 0.5
64 0.59
65 0.61
66 0.66
67 0.75
68 0.81
69 0.8
70 0.8
71 0.79
72 0.79
73 0.83
74 0.81
75 0.76
76 0.72
77 0.67
78 0.62
79 0.57
80 0.51
81 0.45
82 0.42
83 0.38
84 0.33
85 0.29
86 0.23
87 0.19
88 0.14
89 0.13
90 0.13
91 0.14
92 0.14
93 0.21
94 0.23
95 0.25
96 0.31
97 0.38
98 0.44
99 0.48