Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9UWR8

Protein Details
Accession A0A1L9UWR8    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MPKEKTTRKTKARGPERRKKDPNAPKRGLSBasic
NLS Segment(s)
PositionSequence
5-27KTTRKTKARGPERRKKDPNAPKR
Subcellular Location(s) nucl 22, cyto_nucl 14.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKEKTTRKTKARGPERRKKDPNAPKRGLSAYMFFANENREKVREENPGISFGQVGKMLGERWKALKDADRRPYEEKAAADKKRYEDEKASYNAAAEEDEESS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.86
3 0.86
4 0.88
5 0.88
6 0.85
7 0.85
8 0.85
9 0.85
10 0.85
11 0.8
12 0.72
13 0.68
14 0.62
15 0.55
16 0.46
17 0.37
18 0.3
19 0.27
20 0.25
21 0.2
22 0.19
23 0.2
24 0.2
25 0.2
26 0.18
27 0.17
28 0.19
29 0.21
30 0.25
31 0.28
32 0.28
33 0.3
34 0.29
35 0.3
36 0.28
37 0.26
38 0.21
39 0.14
40 0.13
41 0.09
42 0.08
43 0.06
44 0.07
45 0.07
46 0.1
47 0.11
48 0.1
49 0.12
50 0.14
51 0.14
52 0.15
53 0.22
54 0.27
55 0.35
56 0.43
57 0.45
58 0.48
59 0.52
60 0.54
61 0.51
62 0.47
63 0.4
64 0.4
65 0.45
66 0.45
67 0.46
68 0.47
69 0.46
70 0.51
71 0.52
72 0.48
73 0.45
74 0.46
75 0.48
76 0.47
77 0.46
78 0.38
79 0.35
80 0.3
81 0.24
82 0.2
83 0.14