Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9U4B1

Protein Details
Accession A0A1L9U4B1    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
83-109CKWNGFNTGRKTKRPRKRTAATWPLSDHydrophilic
NLS Segment(s)
PositionSequence
92-100RKTKRPRKR
Subcellular Location(s) nucl 22, mito 3
Family & Domain DBs
Amino Acid Sequences MQEIDEAVIAELELLKQPSLPHRGANTMLGLTASDVDRQLKPRRSIDPMVPTRTQCSVTLNDNGPSVLVHAYPDPSHRLSVFCKWNGFNTGRKTKRPRKRTAATWPLSDSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.09
4 0.11
5 0.17
6 0.23
7 0.24
8 0.26
9 0.27
10 0.31
11 0.31
12 0.31
13 0.26
14 0.2
15 0.19
16 0.15
17 0.12
18 0.09
19 0.09
20 0.07
21 0.07
22 0.07
23 0.1
24 0.12
25 0.17
26 0.26
27 0.32
28 0.36
29 0.4
30 0.43
31 0.47
32 0.48
33 0.49
34 0.5
35 0.48
36 0.48
37 0.45
38 0.41
39 0.38
40 0.36
41 0.32
42 0.22
43 0.2
44 0.18
45 0.18
46 0.22
47 0.21
48 0.2
49 0.18
50 0.18
51 0.15
52 0.12
53 0.1
54 0.07
55 0.06
56 0.06
57 0.06
58 0.08
59 0.08
60 0.1
61 0.13
62 0.14
63 0.15
64 0.15
65 0.17
66 0.2
67 0.27
68 0.32
69 0.31
70 0.34
71 0.34
72 0.37
73 0.4
74 0.39
75 0.39
76 0.41
77 0.49
78 0.51
79 0.59
80 0.67
81 0.72
82 0.79
83 0.83
84 0.84
85 0.84
86 0.87
87 0.87
88 0.88
89 0.88
90 0.82
91 0.77