Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0VCH7

Protein Details
Accession G0VCH7    Localization Confidence High Confidence Score 17
NoLS Segment(s)
PositionSequenceProtein Nature
77-100LAKGTSCYRPRRNGERKRKSVRGSHydrophilic
178-201LVTPQRLQRKRHQKALKVRNAQAQHydrophilic
NLS Segment(s)
PositionSequence
87-96RRNGERKRKS
187-189KRH
214-236KRLAERKAEKAEVRKRRASSLKA
Subcellular Location(s) nucl 11.5, cyto_nucl 11, cyto 9.5, mito 3, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR014401  Ribosomal_S6_euk  
IPR001377  Ribosomal_S6e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ncs:NCAS_0C01970  -  
Pfam View protein in Pfam  
PF01092  Ribosomal_S6e  
Amino Acid Sequences MKLNISYPVNGTQKTIEIDDEHRIRVFYDKRIGQEVDGETIGDEFKGYTFKIAGGNDKQGFAMKQGVLLPTRVKLLLAKGTSCYRPRRNGERKRKSVRGSIVGPDLAVLALIITKKGEQEFEGVTDATVPKRLGPKRANNIRKFFGLTKEDDVRDFVIRREVTKGEKTYTKAPKIQRLVTPQRLQRKRHQKALKVRNAQAQREAAAEYAQLLAKRLAERKAEKAEVRKRRASSLKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.29
3 0.23
4 0.21
5 0.24
6 0.31
7 0.31
8 0.3
9 0.28
10 0.27
11 0.26
12 0.31
13 0.32
14 0.31
15 0.37
16 0.39
17 0.41
18 0.46
19 0.46
20 0.38
21 0.4
22 0.35
23 0.29
24 0.25
25 0.22
26 0.16
27 0.16
28 0.15
29 0.09
30 0.07
31 0.05
32 0.05
33 0.07
34 0.07
35 0.08
36 0.08
37 0.1
38 0.14
39 0.15
40 0.21
41 0.23
42 0.3
43 0.29
44 0.29
45 0.28
46 0.26
47 0.25
48 0.2
49 0.22
50 0.14
51 0.15
52 0.16
53 0.18
54 0.17
55 0.18
56 0.18
57 0.14
58 0.15
59 0.13
60 0.12
61 0.12
62 0.14
63 0.18
64 0.18
65 0.18
66 0.19
67 0.23
68 0.27
69 0.31
70 0.37
71 0.38
72 0.45
73 0.52
74 0.6
75 0.68
76 0.74
77 0.8
78 0.82
79 0.86
80 0.86
81 0.87
82 0.8
83 0.76
84 0.71
85 0.65
86 0.57
87 0.49
88 0.42
89 0.34
90 0.3
91 0.22
92 0.16
93 0.1
94 0.07
95 0.04
96 0.02
97 0.03
98 0.03
99 0.03
100 0.03
101 0.04
102 0.05
103 0.05
104 0.06
105 0.06
106 0.08
107 0.08
108 0.09
109 0.1
110 0.09
111 0.08
112 0.09
113 0.09
114 0.07
115 0.09
116 0.08
117 0.09
118 0.17
119 0.2
120 0.27
121 0.34
122 0.43
123 0.51
124 0.62
125 0.69
126 0.68
127 0.72
128 0.66
129 0.6
130 0.55
131 0.46
132 0.42
133 0.36
134 0.31
135 0.31
136 0.32
137 0.31
138 0.28
139 0.28
140 0.23
141 0.23
142 0.21
143 0.17
144 0.2
145 0.2
146 0.21
147 0.23
148 0.24
149 0.26
150 0.32
151 0.33
152 0.3
153 0.34
154 0.36
155 0.41
156 0.48
157 0.48
158 0.49
159 0.52
160 0.58
161 0.6
162 0.62
163 0.59
164 0.6
165 0.64
166 0.66
167 0.67
168 0.65
169 0.69
170 0.72
171 0.72
172 0.72
173 0.74
174 0.73
175 0.76
176 0.79
177 0.78
178 0.81
179 0.86
180 0.86
181 0.83
182 0.8
183 0.79
184 0.77
185 0.71
186 0.66
187 0.57
188 0.48
189 0.4
190 0.36
191 0.27
192 0.2
193 0.17
194 0.12
195 0.11
196 0.12
197 0.11
198 0.12
199 0.13
200 0.15
201 0.2
202 0.24
203 0.28
204 0.35
205 0.39
206 0.45
207 0.52
208 0.56
209 0.57
210 0.63
211 0.68
212 0.7
213 0.74
214 0.74
215 0.69
216 0.72