Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0VBG0

Protein Details
Accession G0VBG0    Localization Confidence High Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
14-40LLAKGTSCYRPRRNGERKRKSVRGSIVHydrophilic
117-138VTPQRLQRKRHQKALKVRNAQAHydrophilic
NLS Segment(s)
PositionSequence
25-34RRNGERKRKS
125-127KRH
152-174KRLAERKAEKAEVRKRRASSLKA
Subcellular Location(s) mito 19.5, cyto_mito 11.833, nucl 4.5, cyto_nucl 4.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR001377  Ribosomal_S6e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ncs:NCAS_0B02020  -  
Pfam View protein in Pfam  
PF01092  Ribosomal_S6e  
Amino Acid Sequences MKQGVLLPTRVKLLLAKGTSCYRPRRNGERKRKSVRGSIVGPDLAVLALIITKKGEQEFEGVTDATVPKRLGPKRANNIRKFFGLTKEDDVRDFVIRREVTKGEKTYTKAPKIQRLVTPQRLQRKRHQKALKVRNAQAQREAAAEYAQLLAKRLAERKAEKAEVRKRRASSLKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.27
4 0.28
5 0.33
6 0.39
7 0.43
8 0.48
9 0.48
10 0.55
11 0.63
12 0.7
13 0.76
14 0.81
15 0.86
16 0.87
17 0.9
18 0.9
19 0.9
20 0.84
21 0.82
22 0.79
23 0.74
24 0.67
25 0.6
26 0.53
27 0.44
28 0.38
29 0.29
30 0.22
31 0.14
32 0.11
33 0.06
34 0.03
35 0.04
36 0.04
37 0.04
38 0.05
39 0.05
40 0.07
41 0.08
42 0.09
43 0.08
44 0.11
45 0.11
46 0.12
47 0.13
48 0.12
49 0.11
50 0.11
51 0.11
52 0.09
53 0.11
54 0.1
55 0.11
56 0.19
57 0.21
58 0.29
59 0.35
60 0.44
61 0.52
62 0.62
63 0.69
64 0.68
65 0.71
66 0.65
67 0.59
68 0.53
69 0.44
70 0.39
71 0.33
72 0.28
73 0.27
74 0.27
75 0.26
76 0.23
77 0.23
78 0.19
79 0.18
80 0.17
81 0.13
82 0.17
83 0.17
84 0.17
85 0.19
86 0.2
87 0.22
88 0.27
89 0.28
90 0.25
91 0.28
92 0.3
93 0.36
94 0.42
95 0.43
96 0.44
97 0.47
98 0.53
99 0.55
100 0.56
101 0.53
102 0.54
103 0.59
104 0.61
105 0.63
106 0.6
107 0.65
108 0.68
109 0.68
110 0.69
111 0.72
112 0.7
113 0.74
114 0.77
115 0.75
116 0.79
117 0.85
118 0.84
119 0.81
120 0.78
121 0.77
122 0.74
123 0.68
124 0.63
125 0.54
126 0.44
127 0.37
128 0.34
129 0.25
130 0.19
131 0.16
132 0.11
133 0.1
134 0.11
135 0.1
136 0.11
137 0.12
138 0.14
139 0.19
140 0.22
141 0.26
142 0.33
143 0.37
144 0.43
145 0.5
146 0.54
147 0.56
148 0.62
149 0.67
150 0.69
151 0.73
152 0.73
153 0.68
154 0.71